DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wilke-2010-1 in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Wilke GA., Bubeck Wardenburg J. DIP original experiment: DIP-219901X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Role of a disintegrin and metalloprotease 10 in Staphylococcus aureus alpha-hemolysin-mediated cellular injury. Wilke GA., Bubeck Wardenburg J. Only protein-protein interactions imex curation wilke-2010-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wilke GA., Bubeck Wardenburg J. DIP original experiment: DIP-219902X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Role of a disintegrin and metalloprotease 10 in Staphylococcus aureus alpha-hemolysin-mediated cellular injury. Wilke GA., Bubeck Wardenburg J. Only protein-protein interactions imex curation wilke-2010-3 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wilke GA., Bubeck Wardenburg J. DIP original experiment: DIP-219903X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Role of a disintegrin and metalloprotease 10 in Staphylococcus aureus alpha-hemolysin-mediated cellular injury. Wilke GA., Bubeck Wardenburg J. Only protein-protein interactions imex curation radam10 PREDICTED: ADAM metallopeptidase domain 10 protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit hla_staau Alpha-hemolysin hly hla Alpha-toxin protein protein staau Staphylococcus aureus MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN ada10_human Disintegrin and metalloproteinase domain-containing protein 10 ADAM10 KUZ MADM Mammalian disintegrin-metalloprotease Kuzbanian protein homolog CDw156 protein protein human Homo sapiens Human MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMKKMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR hly-radam10-1 3211448 N/A 3211451 unspecified role unspecified role prey prey rabit Oryctolagus cuniculus (Rabbit) Rabbit N/A 3211452 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false hly-radam10-2 3211449 N/A 3211451 unspecified role unspecified role prey prey rabit Oryctolagus cuniculus (Rabbit) Rabbit N/A 3211452 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false hly-adam10-1 3211450 N/A 3211453 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3211452 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false