DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chowdary-2010-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. DIP original experiment: DIP-217571X Nature structural & molecular biology 2010 IMEx Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL. Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. Only protein-protein interactions imex curation chowdary-2010-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. DIP original experiment: DIP-217573X Nature structural & molecular biology 2010 IMEx Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL. Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. Only protein-protein interactions imex curation chowdary-2010-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. DIP original experiment: DIP-217572X Nature structural & molecular biology 2010 IMEx Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL. Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. Only protein-protein interactions imex curation chowdary-2010-4 mouse Mus musculus Mouse bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. DIP original experiment: DIP-217574X Nature structural & molecular biology 2010 IMEx Crystal structure of the conserved herpesvirus fusion regulator complex gH-gL. Chowdary TK., Cairns TM., Atanasiu D., Cohen GH., Eisenberg RJ., Heldwein EE. Only protein-protein interactions imex curation g9i222_hhv2 Envelope glycoprotein L HSV2S333_G04 UL1 gL protein protein hhv2 Human herpesvirus 2 Human herpes simplex virus 2 HHV-2 MGFVCLFGLVVMGAWGAWGGSQATEYVLRSVIAKEVGDILRVPCMRTPADDVSWRYEAPSVIDYARIDGIFLRYHCPGLDTFLWDRHAQRAYLVNPFLFAAGFLEDLSHSVFPADTQETTTRRALYKEIRDALGSRKQAVSHAPVRAGCVNFDYSRTRRCVGRRDLRPANTTSTWEPPVSSDDEASSQSKPLATQPPVLALSNAPPRRVSPTRGRRRHTRLRRN CD585849250D7C1F gh Envelope glycoprotein H protein protein hhv2 Human herpesvirus 2 Human herpes simplex virus 2 HHV-2 gb Envelope glycoprotein B protein protein hhv2 Human herpesvirus 2 Human herpes simplex virus 2 HHV-2 gh-gl-2 3210904 N/A 3210908 unspecified role unspecified role prey prey Region 20-224 Region 20-224 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3210909 unspecified role unspecified role bait bait Region 48-803 Region 48-803 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false gh-gl-3 3210905 N/A 3210908 unspecified role unspecified role unspecified role unspecified role Region 20-224 Region 20-224 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3210909 unspecified role unspecified role unspecified role unspecified role Region 48-803 Region 48-803 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gh-gl-4 3210906 N/A 3210908 unspecified role unspecified role unspecified role unspecified role Region 20-224 Region 20-224 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3210909 unspecified role unspecified role unspecified role unspecified role Region 48-803 Region 48-803 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gb-gh-6 3210907 N/A 3210910 unspecified role unspecified role unspecified role unspecified role C-terminal domain of EGFP EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false mouse Mus musculus Mouse N/A 3210909 unspecified role unspecified role unspecified role unspecified role N-terminal domain of EGFP EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false mouse Mus musculus Mouse direct interaction direct interaction false false false