DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ poyraz-2010-1 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217559X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation poyraz-2010-2 in vitro In vitro polymerization polymerization predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217555X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation poyraz-2010-3 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217560X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation poyraz-2010-4 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217556X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation poyraz-2010-5 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217561X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation poyraz-2010-6 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217557X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation poyraz-2010-7 in vitro In vitro x-ray fiber diffrac x-ray fiber diffraction X-ray X-ray x-ray fiber diffrac predetermined predetermined participant predetermined Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. DIP original experiment: DIP-217558X Nature structural & molecular biology 2010 IMEx Protein refolding is required for assembly of the type three secretion needle. Poyraz O., Schmidt H., Seidel K., Delissen F., Ader C., Tenenboim H., Goosmann C., Laube B., Thünemann AF., Zychlinsky A., Baldus M., Lange A., Griesinger C., Kolbe M. Only protein-protein interactions imex curation prgi_salty Protein PrgI prgI STM2873 protein protein salty Salmonella typhimurium MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR ED1F8967877585F8 mxih_shifl Protein MxiH mxiH CP0137 protein protein shifl Shigella flexneri MSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR prgi-1 3210363 N/A 3210370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgi-2 3210364 N/A 3210370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mxih-1 3210365 N/A 3210371 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgi-3 3210366 N/A 3210370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgi-4 3210367 N/A 3210370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgi-5 3210368 N/A 3210370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgi-6 3210369 N/A 3210370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false