DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bange-2010-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221254X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221260X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221257X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221258X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-5 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221262X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221256X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221263X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221255X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-9 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221261X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2010-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. DIP original experiment: DIP-221259X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system. Bange G., Kümmerer N., Engel C., Bozkurt G., Wild K., Sinning I. Only protein-protein interactions imex curation fla_bacsu Flagellin GSX1 Hag BSU35360 hag protein protein bacsu Bacillus subtilis MRINHNIAALNTLNRLSSNNSASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLEMASKNSQDGISLIQTAEGALTETHAILQRVRELVVQAGNTGTQDKATDLQSIQDEISALTDEIDGISNRTEFNGKKLLDGTYKVDTATPANQKNLVFQIGANATQQISVNIEDMGADALGIKEADGSIAALHSVNDLDVTKFADNAADTADIGFDAQLKVVDEAINQVSSQRAKLGAVQNRLEHTINNLSASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQQPQNVLQLLR A28AEFFDB1316684 mint flis_bacsu Flagellar secretion chaperone FliS fliS BSU35330 protein protein bacsu Bacillus subtilis MAIQNPYTAYQQNSVNTATPGELTLMLYNGCLKFIRLAAQAIENDDMERKNENLIKAQNIIQELNFTLNRNIELSASMGAMYDYMYRRLVQANIKNDTGMLAEVEGYVTDFRDAWKQAIQSERKDRHGSGGIA E0E80476A96F14D3 flha_bacsu Flagellar biosynthesis protein FlhA flhA BSU16390 protein protein bacsu Bacillus subtilis MSTRDLSVLISVVLIVAMLVIPFPPWLLSILIIINISLALIVLLTTMNMQEALQFSIFPSLLLLLTLFRLGLNVSTTRSILSHGEGGKVVETFGNFVVGGNVLVGLVVFIILIIIQFIVITKGAERVSEVAARFTLDAMPGKQMSIDADLNAGMITEQEAKHRREKVAREADFYGAMDGASKFVKGDAIAGIIIVMINIIFGIVIGMLQQGMSIQEAASHFTMLTVGDGIVSQIPALLISTATGIVVTRAASEGNLGHDITGQLFAYPKLLYVAAATIMLLGIFTPIGILLTGPLAGLLAFGAYTLSKSGKEKEEVDEILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQGGDLLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLAMSPTPEDDLIEGIETVEPSFGLPAKWISEAVKDEADMLGYTVVDPASVVSTHITEKIKQHAHELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFETLADYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEHGNYLSLEPDISESIVRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSYNELEANVEVQSIGVVDI C7FF66FA886D7203 flij_bacsu Flagellar FliJ protein fliJ Chemotaxis CheF protein cheF BSU16250 protein protein bacsu Bacillus subtilis MAYQFRFQKLLELKENEKDQSLSEYQQSVSEFENVAEKLYENMSKKELLEQNKEKKLKSGMSVQEMRHYQQFVSNLDNTIYHYQKLVIMKRNQMNQKQEILTEKNIEVKKFEKMREKQFKMFALEDKAAEMKEMDDISIKQFMIQGH 5B2B038AA36DDFFE flit_bacsu Flagellar protein FliT fliT BSU35320 protein protein bacsu Bacillus subtilis MNNIDQLYTETKSMLSHIQNTPESDELLKQIEDFVATRSELIQEISLPLSEEERKQMKLILTWDQLIVKEMERLKQSIATELQQMKRKRVMHTTYLNPYNNITIDGTYYDKRK 5AA78802EBDBAB8E flid_bacsu Flagellar hook-associated protein 2 fliD Filament cap protein Flagellar cap protein mrgB BSU35340 protein protein bacsu Bacillus subtilis MVTRITGLASGMDIDDIVSKLMQTERAPLDKLTQKKQTLEWQRDSYREVNSKIKELQDYMSKNTLTYPSTYQSKTVTSSNESVLTATGSVSAPNSSSTVEVASLATAATYKANNYTGYTQGDYNLAFNVVAPGETTAKTVNISVTSADTIDNVISKLNSSDLGVSAFKDKIWNGTEYVETIAFSSKATGAGGSIQAADSATADFMSGQLGFSLDADNKLTAYKEGTNAKVTINGFEMEKLTNNFTVNGVTYSIKNTTAATGPVTTSVSTDVDGIYNQIKEFVDKYNELVDSLNEKLKEEKYRDYTPLTSEQKEAMSDKEVELWEEKAKSGLLRNDSSISTGTNQMRTDFYTQVNADGKTYQLTEFGITTSSAYQLRGHLEINEEKLKAKIAEDPQGVANLFTSGTNDSNYSDKGIMKRITNTLRSTVKSIEAKAGNSTMGASSYSIGKNLNSISTEITDMQDRLNTIENRYYSKFSAMDSAIQKMNEQASYLSQLLVQ 08254112E9564E5F flha-flagellin-1 3209855 N/A 3209865 unspecified role unspecified role prey prey baciu Bacillus subtilis N/A 3209866 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false flha-flij-1 3209856 N/A 3209868 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209869 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false flha-flagellin-2 3209857 N/A 3209865 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209866 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Region 340-677 Region 340-677 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 483-677 Region 483-677 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 302-481 Region 302-481 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 427-431 Region 427-431 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 445-449 Region 445-449 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 453-457 Region 453-457 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false flha-flid-1 3209858 N/A 3209868 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209869 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209870 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false flid-flit-6 3209859 N/A 3209869 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3209870 unspecified role unspecified role unspecified role unspecified role Region 404-498 Region 404-498 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flha-flid-2 3209860 N/A 3209869 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209870 unspecified role unspecified role prey prey Region 404-498 Region 404-498 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false flha-flid-3 3209861 N/A 3209869 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209870 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 483-677 Region 483-677 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 302-481 Region 302-481 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 427-431 Region 427-431 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 445-449 Region 445-449 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 453-457 Region 453-457 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false flha-flagellin-3 3209862 N/A 3209865 unspecified role unspecified role prey prey Region 244-304 Region 244-304 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3209866 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false flid-flit-7 3209863 N/A 3209869 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3209870 unspecified role unspecified role unspecified role unspecified role Region 404-498 Region 404-498 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flha-flij-2 3209864 N/A 3209868 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3209867 unspecified role unspecified role bait bait Cytosolic domain Region 302-677 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 302-339 Region 302-339 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false