DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ni-2010-1 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ni L., Xu W., Kumaraswami M., Schumacher MA. DIP original experiment: DIP-219859X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition. Ni L., Xu W., Kumaraswami M., Schumacher MA. Only protein-protein interactions imex curation ni-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ni L., Xu W., Kumaraswami M., Schumacher MA. DIP original experiment: DIP-219856X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition. Ni L., Xu W., Kumaraswami M., Schumacher MA. Only protein-protein interactions imex curation ni-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ni L., Xu W., Kumaraswami M., Schumacher MA. DIP original experiment: DIP-219857X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition. Ni L., Xu W., Kumaraswami M., Schumacher MA. Only protein-protein interactions imex curation ni-2010-4 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Ni L., Xu W., Kumaraswami M., Schumacher MA. DIP original experiment: DIP-219858X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition. Ni L., Xu W., Kumaraswami M., Schumacher MA. Only protein-protein interactions imex curation tubz_bacti Tubulin-like protein TubZ tubZ FtsZ-like protein TubZ-Bt ATN07_33550 pBt156 protein protein bacti Bacillus thuringiensis subsp. israelensis MLLNSNELEHIHSTNHSVNDISIRWGVIGAGQKGNKEADLFAGYKFSNGTTCYPTLAVNFAESDMMHLQNIIKEDRIHFDGLKGAARTPSVVTDLFDPETNPNANGYLDKLAQELGRKFTNEEGEVIVDQFLICLGAGGGVGTGWGSLVLQLIREQFFPCPVSMLISLPSGDPDEINNALVLLSEIDEFMREQDRLFGNSDIKPLANVIVNDNTQMQRIIESQKGTKDLKNRYVNWKEVANDNVVSTLHEINIIPENYGSDNVTYDPSDLIKLLSIPGRFLTIGKARIAKFDLHSLENSIKRSLDEGFFSAEHQFETATMYGGFVLRPSNADFFKDVNTENRIRNTLGEYKRLDEIAGKFGDPIWDNEYAVCYTIFAGMTMPKRYISLAREGKELAEKQEQLRAEAQRKQDEEKVDISFATNRVQKNTFNPYNKNQGFGGASRFSGGKNSAFKRQTSEATSTQNQQEEENIISTLKTSNPFKKR tubr_bacti DNA-binding transcriptional repressor TubR tubR pBt157 ATN07_33545 protein protein bacti Bacillus thuringiensis subsp. israelensis MNRDHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMRNL pbt156-1 3209746 N/A 3209750 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pbt157-1 3209747 N/A 3209751 unspecified role unspecified role unspecified role unspecified role Q8KNP2:p.Ser63Arg S63R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q8KNP2:p.Ala67Arg A67R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pbt157-2 3209748 N/A 3209751 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pbt156-pbt157-1 3209749 N/A 3209750 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3209751 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false