DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yoon-2010-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. DIP original experiment: DIP-216880X Structure (London, England : 1993) 2010 IMEx Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. Only protein-protein interactions imex curation yoon-2010-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. DIP original experiment: DIP-216882X Structure (London, England : 1993) 2010 IMEx Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. Only protein-protein interactions imex curation yoon-2010-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. DIP original experiment: DIP-216885X Structure (London, England : 1993) 2010 IMEx Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. Only protein-protein interactions imex curation yoon-2010-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. DIP original experiment: DIP-216883X Structure (London, England : 1993) 2010 IMEx Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. Only protein-protein interactions imex curation yoon-2010-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. DIP original experiment: DIP-216881X Structure (London, England : 1993) 2010 IMEx Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. Only protein-protein interactions imex curation yoon-2010-8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. DIP original experiment: DIP-216884X Structure (London, England : 1993) 2010 IMEx Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon SI., Jones BC., Logsdon NJ., Harris BD., Deshpande A., Radaeva S., Halloran BA., Gao B., Walter MR. Only protein-protein interactions imex curation i10r2_human Interleukin-10 receptor subunit beta IL10RB CRFB4 D21S58 D21S66 Cytokine receptor class-II member 4 Cytokine receptor family 2 member 4 Interleukin-10 receptor subunit 2 protein protein human Homo sapiens Human MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS il10_human Interleukin-10 IL10 Cytokine synthesis inhibitory factor protein protein human Homo sapiens Human MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN il22_human Interleukin-22 IL22 ILTIF UNQ3099/PRO10096 ZCYTO18 IL-10-related T-cell-derived-inducible factor Cytokine Zcyto18 protein protein human Homo sapiens Human MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI Cytokine that contributes to the inflammatory response in vivo mint i22r1_human Interleukin-22 receptor subunit alpha-1 IL22RA1 IL22R Cytokine receptor class-II member 9 Cytokine receptor family 2 member 9 ZcytoR11 protein protein human Homo sapiens Human MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES i10r1_human Interleukin-10 receptor subunit alpha IL10RA IL10R Interleukin-10 receptor subunit 1 CDw210a protein protein human Homo sapiens Human MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE q9j4b7_hcmv Viral interleukin-10 homolog UL111A HHV5wtgp098 protein protein hhv-5 Human cytomegalovirus HHV-5 Human herpesvirus 5 MLSVMVSSSLVLIVFFLGASEEAKPATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK il10-il10rb-1 3208752 N/A 3208758 unspecified role unspecified role prey prey Extracellular domain Region 20-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q08334:p.Tyr82Ala Y82A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3208759 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false il22-il22ra1-4 3208753 N/A 3208760 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3208761 unspecified role unspecified role prey prey Extracellular domain Region 16-228 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false il22-il10rb-1 3208754 N/A 3208760 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3208758 unspecified role unspecified role prey prey Extracellular domain Region 20-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q08334:p.Tyr82Ala Y82A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false il10-il10ra-7 3208755 N/A 3208762 unspecified role unspecified role prey prey Region 22-235 Region 22-235 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3208759 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false ul111a-il10ra-2 3208756 N/A 3208763 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3208762 unspecified role unspecified role prey prey Extracellular domain Region 22-235 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false ul111a-il10rb-1 3208757 N/A 3208758 unspecified role unspecified role prey prey Extracellular domain Region 20-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q08334:p.Tyr82Ala Y82A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3208763 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false