DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ vander-2010-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216940X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation vander-2010-2 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216944X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation vander-2010-3 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216945X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation vander-2010-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216942X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation vander-2010-5 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216941X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation vander-2010-6 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down predetermined predetermined participant predetermined Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216946X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation vander-2010-7 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. DIP original experiment: DIP-216943X Structure (London, England : 1993) 2010 IMEx The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Vander Kooi CW., Ren L., Xu P., Ohi MD., Gould KL., Chazin WJ. Only protein-protein interactions imex curation cwc2_yeast Pre-mRNA-splicing factor CWC2 CWC2 YDL209C D1041 NTC40 SLC3 Complexed with CEF1 protein 2 PRP19-associated complex protein 40 Synthetic lethal with CLF1 protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLALRTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMMVHLINNNTNSAGTEVNNKNNERLDRTFPEASVDNVKKRLLPLDNGMESDDFIEKLKKVKKNISRENISSKPSVGKLGGPLLDYLSSDED 371734A11DFDB339 prp19_yeast Pre-mRNA-processing factor 19 PRP19 PSO4 RING-type E3 ubiquitin transferase PRP19 YLL036C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQASLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAKLVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNLELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPRTGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTEYFIWADNRGTIGFQSYEDDSQYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLSSPDQASSRFPVDEEAKIKEVKFADNGYWMVVECDQTVVCFDLRKDVGTLAYPTYTIPEFKTGTVTYDIDDSGKNMIAYSNESNSLTIYKFDKKTKNWTKDEESALCLQSDTADFTDMDVVCGDGGIAAILKTNDSFNIVALTP A44D8C7DD6F64185 cwc2_schpo Pre-mRNA-splicing factor cwf2 Complexed with cdc5 protein 2 Pre-mRNA-processing protein 3 prp3 cwf2 SPAC3A12.11c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSENGLEQEVTVEEKNNDVTEKILVEGEKSKEYEETPRKVKIVKRKKQPARKQIETRPEYEMEPEQPGQVYNLWYNKWSGGMRQDPLKSQVKSETRCVISRDSGYTKADKNPGSFFCLYFARGMCSEGSKCEYLHRLPKDTDFFNANVDCFGREKHADYRDDMGGVGSFLRQNYTLYVGGITPTDDIEEIVSRHFAEWGDIERIRVLNSRGIAFITYLNEANAQFAKEAMAHQSLDHDECLNVRWATTDPNPASQARNQRRLEERAANAVKKLLPKQFLLDLEETKNGKSGNRKRKLELEFGLKGYVPSDDLLYADGANSVHNQLAANEFPNKSQSEEGSNDDHKSVTTTESQNKFVNSQILSDLQVAKQAVHTNQSALVSYYDSDED 5CD36A5C880077DE cef1_schpo Pre-mRNA-splicing factor cdc5 Cell division control protein 5 SPAC644.12 cdc5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVVLKGGAWKNTEDEILKAAVSKYGKNQWARISSLLVRKTPKQCKARWYEWIDPSIKKTEWSREEDEKLLHLAKLLPTQWRTIAPIVGRTATQCLERYQKLLDDLEAKENEQLGLISGEGAEAAAPVNDPNSRLRFGEAEPNLETLPALPDAIDMDEDEKEMLSEARARLANTQGKKAKRKDREKQLELTRRLSHLQKRRELKAAGINIKLFRRKKNEMDYNASIPFEKKPAIGFYDTSEEDRQNFREKREADQKIIENGIRNNEMESEGRKFGHFEKPKPIDRVKKPNKDAQEEKMRRLAEAEQMSKRRKLNLPSPTVSQDELDKVVKLGFAGDRARAMTDTTPDANYSTNLLGKYTQIERATPLRTPISGELEGREDSVTIEVRNQLMRNREQSSLLGQESIPLQPGGTGYTGVTPSHAANGSALAAPQATPFRTPRDTFSINAAAERAGRLASERENKIRLKALRELLAKLPKPKNDYELMEPRFADETDVEATVGVLEEDATDRERRIQERIAEKERLAKARRSQVIQRDLIRPSVTQPEKWKRSLENEDPTANVLLKEMIALISSDAINYPFGNSKVKGTANKVPDLSNEEIERCRLLLKKEIGQLESDDYIQFEKEFLETYSALHNTSSLLPGLVIYEEDDEDVEAAEKFYTNDIQRDLAKKALECNKLENRVYDLVRSSYEQRNFLIKKISHAWKALQTERKNLTCYEFLYNQERLALPNRLEAAEIELSKMQQIEAYAQQDYARVTGQN 9FCA639A2F9A9E84 prp19_schpo Pre-mRNA-processing factor 19 prp19 Complexed with cdc5 protein 8 cwf8 SPAC29A4.08c RING-type E3 ubiquitin transferase PRP19 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFCSISGETPKEPVISRVSGNVYEKRLIEQVIRETSKDPVTQQECTLEDLVPVKVPDFVRPRPPSATSLPALLSLFQEEWDSVALEQFELRRNLTETKQELSTALYSLDAALRVISRLTKERDEAREALAKFSDNIGTVSSKTIEVQEVEMGESDDQLKTSLRSTVEKTFQELSSKRKRTKLQPKWATDDAVSQLLQATPSTILENLETESTTSFFPSPENSSFVLCLHKDELLCLDIQSNSTLKIFEGSALACCWLTSSKIAVATADAISIFEFPVSSSGLQSVGEPTSSIPIDEKVNFLQAHPSGEYLLAASNEKCYIFSLKSQVYNITVAQHITSLAVHPDGNLFVAGLENGELRFFETSSGNELTKFGPHSSPVKTLQFGENGYWLVVTTNDDSDIFIWDLRKSELVQKIPLQTKVAAVSLDITSQLLVSSDGETLYVHIYVKSSKSWRCMSQTHVSSISNLVWLNELHQLLFSTSNGAILRLG 3900431C90A94A41 cwc2-prp19-2 3208625 N/A 3208632 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3208633 unspecified role unspecified role prey prey P32523:p.Tyr387Ala Y387A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P32523:p.Arg403Ala R403A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P32523:p.[Arg403Ala;Lys404Ala] R403A/K404A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P32523:p.Lys404Ala K404A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P32523:p.Asp341Ala D341A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cwc2-prp19-3 3208626 N/A 3208632 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3208633 unspecified role unspecified role unspecified role unspecified role WD40 domain Region 165-503 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cwf2-cwf2-1 3208627 N/A 3208634 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3208634 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false cwc2-prp19-4 3208628 N/A 3208632 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3208633 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cwc2-prp19-5 3208629 N/A 3208632 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminal domain Region 228-339 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3208633 unspecified role unspecified role prey prey P32523:p.[Arg403Ala;Lys404Ala] R403A/K404A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false WD40 domain Region 165-503 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false cdc5-cwf2-1 3208630 N/A 3208635 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3208636 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3208634 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false prp19-6 3208631 N/A 3208633 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false