DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yamamoto-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. DIP original experiment: DIP-219761X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. Only protein-protein interactions imex curation yamamoto-2010-3 ecolx Escherichia coli atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. DIP original experiment: DIP-219762X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. Only protein-protein interactions imex curation yamamoto-2010-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. DIP original experiment: DIP-219763X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Visualization and structural analysis of the bacterial magnetic organelle magnetosome using atomic force microscopy. Yamamoto D., Taoka A., Uchihashi T., Sasaki H., Watanabe H., Ando T., Fukumori Y. Only protein-protein interactions imex curation mama_magmg Magnetosome protein MamA mamA mam22 protein protein magmg Magnetospirillum magnetotacticum Aquaspirillum magnetotacticum MSSKPSDILDEVTLYAHYGLSVAKKLGMNMVDAFRAAFSVNDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASV mam22-1 3208205 N/A 3208208 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mam22-2 3208206 N/A 3208208 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mam22-mam22-1 3208207 N/A 3208208 unspecified role unspecified role prey prey magmg Magnetospirillum magnetotacticum Aquaspirillum magnetotacticum N/A 3208208 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false