IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mazauric-2010-1 ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mazauric MH., Dirick L., Purushothaman SK., Björk GR., Lapeyre B. Bands aligned to those identified by western blot to confirm identification bruno.lapeyre@crbm.cnrs.fr The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation tr112_yeast Multifunctional methyltransferase subunit TRM112 YNR046W N3445 TRM112 tRNA methyltransferase 112 eRF1 methyltransferase subunit TRM112 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV trm9_yeast tRNA (carboxymethyluridine(34)-5-O)-methyltransferase YML014W YM9571.04 TRM9 tRNA [Um34] methyltransferase tRNA methylase 9 tRNA (uracil-5-)-methyltransferase TRM9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEINQAAEKEQEYVHKVYNEIAPHFSQTRYKPWPIVTQFLKTRPMGSIGIDVGCGNGKYLGVNPDIYIIGSDRSDGLIECARGINPSYNLLVADGLNLPHKNETFDFAISIAVVHHWSTRERRVEVIRHVLSKLRQGGQALIYCWALEQGSSRRGYHEGMEQDVFVPWVLPKSKSKPKTKSTPPAKVKTRPKPNLMNIPPKERSEYLQRWKEEQQRSKSLDDNDEKQQQDQEQEREEVKYRYYHLYREGELAEDCRQAGAAVHSEGFERDNWWVVAQKR trm112-trm9-1 2959948 N/A 2959949 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2959950 unspecified role unspecified role prey prey region s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1