DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tanabe-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216398X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation tanabe-2010-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216395X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation tanabe-2010-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216396X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation tanabe-2010-4 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216397X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation q9z3b6_neime porB protein protein neime Neisseria meningitidis EVSRVKNQGVKTKTATQIADFGSKIGFKGQEDLGNGMKAIWQLEQKASIAGTNSGWGNRQSFIGLKGGFGTVRVGNLNTVLKDSGDNVNAWESGSNTGDVLGLGTIGRVESREISVRYDSPVFAGFSGSVQYVPRDNANDKDKYTHKQSSRESYHAGLKYENAGFFGQYAGSFAKYADLKDNAERVAVGTTGAHPVKDYQVHRVVAGYDANDLYVSVAGQYEAAKNNDTNPATNGKKLEQTQVAATAAYRFGNVTPRVSYAHGFKAKVNGKKAARYQYDQVIVGADYDFSKRTSALVSVGWLKEGKGVNKTEKTASM tlr2_human Toll-like receptor 2 Toll/interleukin-1 receptor-like protein 4 TLR2 TIL4 protein protein human Homo sapiens Human MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS porb-1 3206442 N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false porb-2 3206443 N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false porb-tlr2-1 3206444 N/A 3206447 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 19-588 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false porb-3 3206445 N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false