DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kedrov-2010-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Kedrov A., Hellawell AM., Klosin A., Broadhurst RB., Kunji ER., Müller DJ. DIP original experiment: DIP-133855X Structure (London, England : 1993) 2010 IMEx Probing the interactions of carboxy-atractyloside and atractyloside with the yeast mitochondrial ADP/ATP carrier. Kedrov A., Hellawell AM., Klosin A., Broadhurst RB., Kunji ER., Müller DJ. Only protein-protein interactions imex curation kedrov-2010-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Kedrov A., Hellawell AM., Klosin A., Broadhurst RB., Kunji ER., Müller DJ. DIP original experiment: DIP-133856X Structure (London, England : 1993) 2010 IMEx Probing the interactions of carboxy-atractyloside and atractyloside with the yeast mitochondrial ADP/ATP carrier. Kedrov A., Hellawell AM., Klosin A., Broadhurst RB., Kunji ER., Müller DJ. Only protein-protein interactions imex curation adt3_yeast ADP,ATP carrier protein 3 AAC3 Adenine nucleotide translocator 3 ADP/ATP translocase 3 YBR0753 YBR085W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMILFGKKFK D0C1329FEC1B4DC8 aac3p-1 3204181 N/A 3204183 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false aac3p-2 3204182 N/A 3204183 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false