DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cammett-2010-1 human Homo sapiens Human comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Cammett TJ., Jun SJ., Cohen EB., Barrera FN., Engelman DM., Dimaio D. DIP original experiment: DIP-220910X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Construction and genetic selection of small transmembrane proteins that activate the human erythropoietin receptor. Cammett TJ., Jun SJ., Cohen EB., Barrera FN., Engelman DM., Dimaio D. Only protein-protein interactions imex curation ve5_bpv1 Protein E5 E5 protein protein bpv1 Bovine papillomavirus type 1 MPNLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF This sequence has been withdrawn from Uniprot. 0E278099E06F2956 mint E5 can induce cellular DNA synthesis. It seems to interact with a 16 kDa cellular protein. E5 seems to activate the PDGF receptor e5-1 3204045 N/A 3204046 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human covalent binding covalent binding false false false