DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2010-8 human Homo sapiens Human comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219215X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation zhao-2010-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219213X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation zhao-2010-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219209X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation zhao-2010-11 in vitro In vitro pull down pull down autoradiography autoradiography Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219211X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation zhao-2010-12 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219214X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation zhao-2010-13 in vitro In vitro pull down pull down autoradiography autoradiography Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219210X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation zhao-2010-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219212X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions imex curation isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS ns1_i72a2 Non-structural protein 1 NS NS1A protein protein i72a2 Influenza A virus (strain A/Udorn/307/1972 H3N2) MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILKEESDEALKMTMASTPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGSSNENGRPPLTPKQKRKMARTARSKVRRDKMAD herc5_human E3 ISG15--protein ligase HERC5 HERC5 CEB1 CEBP1 HECT domain and RCC1-like domain-containing protein 5 Cyclin-E-binding protein 1 protein protein human Homo sapiens Human MERRSRRKSRRNGRSTAGKAAATQPAKSPGAQLWLFPSAAGLHRALLRRVEVTRQLCCSPGRLAVLERGGAGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFEYDNYSMKHLRFESILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPVKVSSSEELKLESHTSEKELIMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWQSTKREIQEIFSSPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDWITNMITTCLKDNLLKRLPFHSPPQEALEIFFLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVLEEYWATLQESTFSKLVQMFKTAVICQLDYWDESAEENGNVQALLEMLKKLHRVNQVKCQLPESIFQVDELLHRLNFFVEVCRRYLWKMTVDASENVQCCVIFSHFPFIFNNLSKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFFGVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHWDRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG isg15-ns-1 3203846 N/A 3203853 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3203854 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human covalent binding covalent binding false false false ns-isg15-1 3203847 N/A 3203853 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3203854 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ns-isg15-2 3203848 N/A 3203853 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3203854 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ns-herc5-1 3203849 N/A 3203855 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RCC domain Region 1-364 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3203854 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false isg15-ns-2 3203850 N/A 3203853 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3203854 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ns-herc5-2 3203851 N/A 3203855 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3203854 unspecified role unspecified role bait bait Region 1-73 Region 1-73 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 74-238 Region 74-238 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false herc5-ns-1 3203852 N/A 3203855 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3203854 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false