DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wong-2010-3 in vitro In vitro light microscopy light microscopy predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. DIP original experiment: DIP-215951X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Methionine oxidation induces amyloid fibril formation by full-length apolipoprotein A-I. Wong YQ., Binger KJ., Howlett GJ., Griffin MD. Only protein-protein interactions imex curation wong-2010-4 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. DIP original experiment: DIP-215947X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Methionine oxidation induces amyloid fibril formation by full-length apolipoprotein A-I. Wong YQ., Binger KJ., Howlett GJ., Griffin MD. Only protein-protein interactions imex curation wong-2010-5 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. DIP original experiment: DIP-215948X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Methionine oxidation induces amyloid fibril formation by full-length apolipoprotein A-I. Wong YQ., Binger KJ., Howlett GJ., Griffin MD. Only protein-protein interactions imex curation wong-2010-6 in vitro In vitro x-ray fiber diffrac x-ray fiber diffraction X-ray X-ray x-ray fiber diffrac predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. DIP original experiment: DIP-215949X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Methionine oxidation induces amyloid fibril formation by full-length apolipoprotein A-I. Wong YQ., Binger KJ., Howlett GJ., Griffin MD. Only protein-protein interactions imex curation wong-2010-7 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. DIP original experiment: DIP-215950X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Methionine oxidation induces amyloid fibril formation by full-length apolipoprotein A-I. Wong YQ., Binger KJ., Howlett GJ., Griffin MD. Only protein-protein interactions imex curation apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ apoa1-3 3203802 N/A 3203807 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false apoa1-4 3203803 N/A 3203807 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false apoa1-5 3203804 N/A 3203807 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false apoa1-6 3203805 N/A 3203807 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false apoa1-7 3203806 N/A 3203807 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false