DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ peterson-2010-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Peterson DW., Ando DM., Taketa DA., Zhou H., Dahlquist FW., Lew J. DIP original experiment: DIP-219255X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx No difference in kinetics of tau or histone phosphorylation by CDK5/p25 versus CDK5/p35 in vitro. Peterson DW., Ando DM., Taketa DA., Zhou H., Dahlquist FW., Lew J. Only protein-protein interactions imex curation peterson-2010-2 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Peterson DW., Ando DM., Taketa DA., Zhou H., Dahlquist FW., Lew J. DIP original experiment: DIP-219257X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx No difference in kinetics of tau or histone phosphorylation by CDK5/p25 versus CDK5/p35 in vitro. Peterson DW., Ando DM., Taketa DA., Zhou H., Dahlquist FW., Lew J. Only protein-protein interactions imex curation peterson-2010-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Peterson DW., Ando DM., Taketa DA., Zhou H., Dahlquist FW., Lew J. DIP original experiment: DIP-219256X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx No difference in kinetics of tau or histone phosphorylation by CDK5/p25 versus CDK5/p35 in vitro. Peterson DW., Ando DM., Taketa DA., Zhou H., Dahlquist FW., Lew J. Only protein-protein interactions imex curation cd5r1_human Cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit CDK5R1 CDK5R NCK5A protein protein human Homo sapiens Human MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR cdk5_human Cyclin-dependent-like kinase 5 CDK5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE CDKN5 protein protein human Homo sapiens Human MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP cdk5-cdk5r1-9 3203154 N/A 3203157 unspecified role unspecified role prey prey p25 subunit Region 99-307 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3203158 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false cdk5-cdk5r1-10 3203155 N/A 3203157 unspecified role unspecified role unspecified role unspecified role p25 subunit Region 99-307 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3203158 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cdk5r1-cdk5-7 3203156 N/A 3203157 unspecified role unspecified role bait bait p25 subunit Region 99-307 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3203158 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false