DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sarafraz_yazdi-2010-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip tag fluorescence tag visualisation by fluorescence tag fluorescence Sarafraz-Yazdi E., Bowne WB., Adler V., Sookraj KA., Wu V., Shteyler V., Patel H., Oxbury W., Brandt-Rauf P., Zenilman ME., Michl J., Pincus MR. DIP original experiment: DIP-215935X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Sarafraz-Yazdi E., Bowne WB., Adler V., Sookraj KA., Wu V., Shteyler V., Patel H., Oxbury W., Brandt-Rauf P., Zenilman ME., Michl J., Pincus MR. Only protein-protein interactions imex curation pcn27 PCN-27 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP mdm2-pcn27-1 3202342 N/A 3202343 unspecified role unspecified role prey prey FITC-Tag FITC-Tag fluorescein fluorescein label fluorescein n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false TAMRA-tag TAMRA-tag fluorescent dye fluorescent dye label fluorescent dye c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro N/A 3202344 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false