DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ waight-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Waight AB., Love J., Wang DN. DIP original experiment: DIP-133959X Nature structural & molecular biology 2010 IMEx Structure and mechanism of a pentameric formate channel. Waight AB., Love J., Wang DN. Only protein-protein interactions imex curation waight-2010-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Waight AB., Love J., Wang DN. DIP original experiment: DIP-133960X Nature structural & molecular biology 2010 IMEx Structure and mechanism of a pentameric formate channel. Waight AB., Love J., Wang DN. Only protein-protein interactions imex curation waight-2010-3 ecolx Escherichia coli electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Waight AB., Love J., Wang DN. DIP original experiment: DIP-133961X Nature structural & molecular biology 2010 IMEx Structure and mechanism of a pentameric formate channel. Waight AB., Love J., Wang DN. Only protein-protein interactions imex curation waight-2010-4 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Waight AB., Love J., Wang DN. DIP original experiment: DIP-133962X Nature structural & molecular biology 2010 IMEx Structure and mechanism of a pentameric formate channel. Waight AB., Love J., Wang DN. Only protein-protein interactions imex curation q9kre7_vibch VC_1695 protein protein vibch Vibrio cholerae MEHNQFDSLLPPQMAERAAITGEGKAKKAAYKSFLLAISAGIQIGIAFVFYTVVTTGAHDMPYGVTKLLGGLAFSLGLILVVITGGELFTSSVLILVAKASGKISWKELVRNWTVVYFGNLCGSIILVFIMLATRQFMEDGGQLGLNAMAISQHKLHHTFLQAFALGLMCNILVCLAVWMTFSARSLTDKVMVLILPVAMFVSSGFEHCIANMFQVPMAIGIKYFAPESFWAMTGANIAQYADLNFVNFIVNNLIPVTLGNIVGGGVFVGMWYWLIYLKD 22D2C9994AD163C1 foca-3 3200876 N/A 3200880 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false foca-4 3200877 N/A 3200880 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false foca-5 3200878 N/A 3200880 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false foca-6 3200879 N/A 3200880 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false