DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2009-54 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang Y., Huang Y., Wang J., Cheng C., Huang W., Lu P., Xu YN., Wang P., Yan N., Shi Y. DIP original experiment: DIP-219610X Nature 2009 IMEx Structure of the formate transporter FocA reveals a pentameric aquaporin-like channel. Wang Y., Huang Y., Wang J., Cheng C., Huang W., Lu P., Xu YN., Wang P., Yan N., Shi Y. Only protein-protein interactions imex curation wang-2009-55 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang Y., Huang Y., Wang J., Cheng C., Huang W., Lu P., Xu YN., Wang P., Yan N., Shi Y. DIP original experiment: DIP-219611X Nature 2009 IMEx Structure of the formate transporter FocA reveals a pentameric aquaporin-like channel. Wang Y., Huang Y., Wang J., Cheng C., Huang W., Lu P., Xu YN., Wang P., Yan N., Shi Y. Only protein-protein interactions imex curation foca_eco57 Probable formate transporter 1 focA Formate channel 1 ECs0987 Z1250 protein protein eco57 Escherichia coli O157:H7 MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTGTMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVWMSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPENFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH foca-1 3199604 N/A 3199606 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false foca-2 3199605 N/A 3199606 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false