DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sohn-2009-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sohn J., Grant RA., Sauer RT. DIP original experiment: DIP-132003X Structure (London, England : 1993) 2009 IMEx OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism. Sohn J., Grant RA., Sauer RT. Only protein-protein interactions imex curation sohn-2009-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sohn J., Grant RA., Sauer RT. DIP original experiment: DIP-132006X Structure (London, England : 1993) 2009 IMEx OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism. Sohn J., Grant RA., Sauer RT. Only protein-protein interactions imex curation sohn-2009-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sohn J., Grant RA., Sauer RT. DIP original experiment: DIP-132004X Structure (London, England : 1993) 2009 IMEx OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism. Sohn J., Grant RA., Sauer RT. Only protein-protein interactions imex curation sohn-2009-5 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Sohn J., Grant RA., Sauer RT. DIP original experiment: DIP-132008X Structure (London, England : 1993) 2009 IMEx OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism. Sohn J., Grant RA., Sauer RT. Only protein-protein interactions imex curation sohn-2009-6 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Sohn J., Grant RA., Sauer RT. DIP original experiment: DIP-132007X Structure (London, England : 1993) 2009 IMEx OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism. Sohn J., Grant RA., Sauer RT. Only protein-protein interactions imex curation sohn-2009-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sohn J., Grant RA., Sauer RT. DIP original experiment: DIP-132005X Structure (London, England : 1993) 2009 IMEx OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism. Sohn J., Grant RA., Sauer RT. Only protein-protein interactions imex curation degs_ecoli Serine endoprotease DegS degS hhoB htrH b3235 JW3204 Site-1 protease DegS Site-1-type intramembrane protease protein protein ecoli Escherichia coli (strain K12) MFVKLLRSVAIGLIVGAILLVAMPSLRSLNPLSTPQFDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPATN dnrdgnvyqf OMP peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DNRDGNVYQF rsea_ecoli Anti-sigma-E factor RseA yfiJ rseA mclA b2572 JW2556 Regulator of SigE Sigma-E anti-sigma factor RseA Sigma-E factor negative regulatory protein protein protein ecoli Escherichia coli (strain K12) MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ kkdnrdgnyyf OMP peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) KKDNRDGNYYF dnrdgnvyyf OMP peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DNRDGNVYYF degs-1 3197872 N/A 3197878 unspecified role unspecified role unspecified role unspecified role Region 27-355 Region 27-355 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degs-dnrdgnvyqf-1 3197873 N/A 3197879 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3197878 unspecified role unspecified role unspecified role unspecified role Region 27-355 Region 27-355 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degs-2 3197874 N/A 3197878 unspecified role unspecified role unspecified role unspecified role Region 27-355 Region 27-355 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degs-rsea-6 3197875 N/A 3197880 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 121-216 Region 121-216 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3197878 enzyme enzyme unspecified role unspecified role Region 27-355 Region 27-355 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli cleavage cleavage reaction cleavage false false false degs-kkdnrdgnyyf-1 3197876 N/A 3197881 unspecified role unspecified role unspecified role unspecified role Fluorescein-label Fluorescein-label fluorescein fluorescein label fluorescein n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3197878 unspecified role unspecified role unspecified role unspecified role Region 27-355 Region 27-355 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P0AEE3:p.His198Pro H198P mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0AEE3:p.[His198Pro;Asp320Ala] H198P/D320A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0AEE3:p.Asp320Ala D320A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0AEE3:p.[His198Pro;Lys243Asp] H198P/K243D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degs-dnrdgnvyyf-1 3197877 N/A 3197882 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3197878 unspecified role unspecified role unspecified role unspecified role Region 27-355 Region 27-355 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false