DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yamada-2009-6 in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. DIP original experiment: DIP-131983X Structure (London, England : 1993) 2009 IMEx Structure of PAS-linked histidine kinase and the response regulator complex. Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. Only protein-protein interactions imex curation yamada-2009-7 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. DIP original experiment: DIP-131986X Structure (London, England : 1993) 2009 IMEx Structure of PAS-linked histidine kinase and the response regulator complex. Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. Only protein-protein interactions imex curation yamada-2009-8 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. DIP original experiment: DIP-131984X Structure (London, England : 1993) 2009 IMEx Structure of PAS-linked histidine kinase and the response regulator complex. Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. Only protein-protein interactions imex curation yamada-2009-9 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. DIP original experiment: DIP-131987X Structure (London, England : 1993) 2009 IMEx Structure of PAS-linked histidine kinase and the response regulator complex. Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. Only protein-protein interactions imex curation yamada-2009-10 in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase predetermined predetermined participant predetermined Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. DIP original experiment: DIP-131985X Structure (London, England : 1993) 2009 IMEx Structure of PAS-linked histidine kinase and the response regulator complex. Yamada S., Sugimoto H., Kobayashi M., Ohno A., Nakamura H., Shiro Y. Only protein-protein interactions imex curation q9x181_thema TM_1360 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDLSSWAADEYVVKSFNFDELKEKVKKLLS 145302A42E89EB78 q9x180_thema TM_1359 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MVPERLKQIKGIRILESEDEIPQEGFTCRFGKHTVVANDEESFEIVRLYKRLTVYELLLSLVDSICVHPKEEALRFSLKKVREFLDAEEVYLIEGDASYSSKGEKLSIDEIKKKHPGASVREWRNKLHLVVVREGAFDEEEEVLCTKLLEFIGNVSEKLWRLKEEVQKLKKSYEEQLKVSEIQKEHIKKMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERGFNFDRAVLLKKDEGTGSLMVVSAVGGDTLQEHEELKRYLRKRTLRYTDLVQFLREEALTFSFETKFNEKIRGKRFYYREHPIFERVVLRKSIVRTSRETLEKIRYEIEDVISILENDEFIVFPLVGRWDTLGVVVVDNKFSKKEVTDLDLDVLKLFSESAGLALENAYNYENLRKKTLDLQRQNELVEHLRNFSESILESLETAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDDVTELYKYEEERKRRERLSILGEMTARVAHEIRNPITIIGGFIMRMKKHLDDPETLKKYINIITNELSRLETIVKEILEYSKERQVLEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRVEADRTRIKQVLINLVQNAIEATGENGKIKITSEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTTKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEIPKTPEKR 61D11F4FDC4D0E9E thka-trra-1 3197751 N/A 3197756 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3197757 enzyme enzyme unspecified role unspecified role Region 408-755 Region 408-755 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false thka-trra-2 3197752 N/A 3197756 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3197757 unspecified role unspecified role unspecified role unspecified role Region 517-755 Region 517-755 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false thka-trra-3 3197753 N/A 3197756 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3197757 enzyme enzyme unspecified role unspecified role Region 408-755 Region 408-755 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false thka-trra-4 3197754 N/A 3197756 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3197757 unspecified role unspecified role unspecified role unspecified role Region 408-755 Region 408-755 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false thka-trra-5 3197755 N/A 3197756 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli N/A 3197757 phosphate donor phosphate donor unspecified role unspecified role Region 517-755 Region 517-755 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer false false false