DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tikhonova-2009-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134553X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134550X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-3 in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134556X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-4 in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134554X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134551X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134557X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134558X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134555X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation tikhonova-2009-9 in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. DIP original experiment: DIP-134552X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Kinetic control of TolC recruitment by multidrug efflux complexes. Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI. Only protein-protein interactions imex curation acra_ecoli Multidrug efflux pump subunit AcrA acrA lir mtcA b0463 JW0452 AcrAB-TolC multidrug efflux pump subunit AcrA Acridine resistance protein A protein protein ecoli Escherichia coli (strain K12) MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS 5B81DD5BC2B0A077 tolc_ecoli Outer membrane protein TolC tolC mtcB mukA refI Multidrug efflux pump subunit TolC Outer membrane factor TolC colE1-i toc weeA JW5503 b3035 protein protein ecoli Escherichia coli (strain K12) MKKLLPILIGLSLSGFSSLSQAENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN emra_ecoli Multidrug export protein EmrA emrA b2685 JW2660 protein protein ecoli Escherichia coli (strain K12) MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGNQIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMINSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQYNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPTTPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVRSTPVAVSTAREISLAPVNKLIDDIVKANAG maca_ecoli Macrolide export protein MacA macA b0878 ybjY JW0862 protein protein ecoli Escherichia coli (strain K12) MKKRKTVKKRYVIALVIVIAGLITLWRILNAPVPTYQTLIVRPGDLQQSVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTAQVHIQLTDVKNVLTIPLSALGDPVGDNRYKVKLLRNGETREREVTIGARNDTDVEIVKGLEAGDEVVIGEAKPGAAQ acra-acra-2 3197002 N/A 3197011 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3197011 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false emra-tolc-1 3197003 N/A 3197012 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3197013 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false maca-1 3197004 N/A 3197014 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false acra-2 3197005 N/A 3197011 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false emra-emra-1 3197006 N/A 3197013 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3197013 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false acra-tolc-1 3197007 N/A 3197011 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3197012 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false maca-tolc-1 3197008 N/A 3197014 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3197012 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false maca-maca-1 3197009 N/A 3197014 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3197014 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false emra-1 3197010 N/A 3197013 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false