DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ payankaulam-2009-1 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Payankaulam S., Arnosti DN. DIP original experiment: DIP-134631X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-2 drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down western blot western blot Immuno blot Immuno blot Payankaulam S., Arnosti DN. DIP original experiment: DIP-134633X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-3 drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down ms participant Identification by mass spectrometry ms participant Payankaulam S., Arnosti DN. DIP original experiment: DIP-134636X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Payankaulam S., Arnosti DN. DIP original experiment: DIP-134634X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-5 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Payankaulam S., Arnosti DN. DIP original experiment: DIP-134632X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-6 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Payankaulam S., Arnosti DN. DIP original experiment: DIP-134635X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Payankaulam S., Arnosti DN. DIP original experiment: DIP-216916X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation payankaulam-2009-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Payankaulam S., Arnosti DN. DIP original experiment: DIP-261812X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Groucho corepressor functions as a cofactor for the Knirps short-range transcriptional repressor. Payankaulam S., Arnosti DN. Only protein-protein interactions imex curation grou_drome Protein groucho gro E(spl)m9/m10 CG8384 Enhancer of split m9/10 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGEKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY knir_drome Zygotic gap protein knirps kni NR0A1 CG4717 Nuclear receptor subfamily 0 group A member 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKACRLRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSASSPVGSPHTPGFGDMAAHLHHHHQQQQQQQVPRHPHMPLLGYPSYLSDPSAALPFFSMMGGVPHQSPFQLPPHLLFPGYHASAAAAAASAADAAYRQEMYKHRQSVDSVESQNRFSPASQPPVVQPTSSARQSPIDVCLEEDVHSVHSHQSSASLLHPIAIRATPTTPTSSSPLSFAAKMQSLSPVSVCSIGGETTSVVPVHPPTVSAQEGPMDLSMKTSRSSVHSFNDSGSEDQEVEVAPRRKFYQLEAECLTTSSSSSSHSAAHSPNTTTAHAEVKRQKLGGAEATHFGGFAVAHNAASAMRGIFVCV ctbp_drome C-terminal-binding protein CtBP CG7583 dCtBP protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDKNLMMPKRSRIDVKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNVFQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNKEYFMRTPPAAAAGGVAAAVYPEGALHHRAHSTTPHDGPHSTTNLGSTVGGGPTTVAQAAAAAVAAAAAAALLPSPVPSHLSPQVGGLPLGIVSSQSPLSAPDPNNHLSSSIKTEVKAESTEAP hair_drome Protein hairy CG6494 h protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW kni-gro-1 3196540 N/A 3196548 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3196549 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false kni-gro-2 3196541 N/A 3196548 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3196549 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false kni-ctbp-1 3196542 N/A 3196550 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3196548 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3196549 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false h-gro-5 3196543 N/A 3196551 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3196548 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false kni-gro-3 3196544 N/A 3196548 unspecified role unspecified role prey prey in vitro In vitro N/A 3196549 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 139-330 Region 139-330 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kni-ctbp-2 3196545 N/A 3196550 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3196548 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3196549 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false h-gro-6 3196546 N/A 3196551 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3196548 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false 1 nodeMerge04 2011-10-17 h-gro-7 3196547 N/A 3196551 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3196548 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false 1 nodeMerge04 2014-07-01