DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2009-5 ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Z., Gandhi CS., Rees DC. DIP original experiment: DIP-219595X Nature 2009 IMEx Structure of a tetrameric MscL in an expanded intermediate state. Liu Z., Gandhi CS., Rees DC. Only protein-protein interactions imex curation liu-2009-6 ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Z., Gandhi CS., Rees DC. DIP original experiment: DIP-219592X Nature 2009 IMEx Structure of a tetrameric MscL in an expanded intermediate state. Liu Z., Gandhi CS., Rees DC. Only protein-protein interactions imex curation liu-2009-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu Z., Gandhi CS., Rees DC. DIP original experiment: DIP-219593X Nature 2009 IMEx Structure of a tetrameric MscL in an expanded intermediate state. Liu Z., Gandhi CS., Rees DC. Only protein-protein interactions imex curation liu-2009-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Liu Z., Gandhi CS., Rees DC. DIP original experiment: DIP-219594X Nature 2009 IMEx Structure of a tetrameric MscL in an expanded intermediate state. Liu Z., Gandhi CS., Rees DC. Only protein-protein interactions imex curation mscl_myctu Large-conductance mechanosensitive channel mscL MTV044.13c Rv0985c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ D682D3F2C1651E9C mscl_staaw Large-conductance mechanosensitive channel mscL MW1235 protein protein staaw Staphylococcus aureus (strain MW2) MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK mtmscl-1 3195455 N/A 3195459 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mscl-5 3195456 N/A 3195460 unspecified role unspecified role unspecified role unspecified role Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mscl-6 3195457 N/A 3195460 unspecified role unspecified role unspecified role unspecified role Region 1-94 Region 1-94 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mscl-7 3195458 N/A 3195460 unspecified role unspecified role unspecified role unspecified role Region 1-94 Region 1-94 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false