DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ye-2009-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. DIP original experiment: DIP-134435X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. Only protein-protein interactions imex curation ye-2009-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. DIP original experiment: DIP-134433X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. Only protein-protein interactions imex curation ye-2009-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. DIP original experiment: DIP-134434X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. Only protein-protein interactions imex curation ye-2009-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. DIP original experiment: DIP-134436X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural organization of box C/D RNA-guided RNA methyltransferase. Ye K., Jia R., Lin J., Ju M., Peng J., Xu A., Zhang L. Only protein-protein interactions imex curation flpa_sacs2 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase flpA C33_014 SSO0940 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MSEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG CFFB34D2D4FA9CF2 q97zh3_sacs2 SSO0939 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MMKIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYRVSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGIIFQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEKFAQPPPKKPQQQKPQQPQKQQAKGKKGGKRRGKRK 1DDA9C2C5E535ED4 rl7a_sacs2 50S ribosomal protein L7Ae rpl7ae Ribosomal protein L8e C04_031 SSO0091 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS 3EE30FC81C1A003D fibrillarin-nop5-1 3194949 N/A 3194953 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194954 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fibrillarin-nop5-2 3194950 N/A 3194953 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194954 unspecified role unspecified role unspecified role unspecified role Region 1-262 Region 1-262 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fibrillarin-l7ae-1 3194951 N/A 3194953 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194955 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3194954 unspecified role unspecified role unspecified role unspecified role Region 1-380 Region 1-380 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false nop5-1 3194952 N/A 3194954 unspecified role unspecified role unspecified role unspecified role Region 135-380 Region 135-380 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false