DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rivera_molina-2009-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rivera-Molina FE., Novick PJ. DIP original experiment: DIP-134439X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A Rab GAP cascade defines the boundary between two Rab GTPases on the secretory pathway. Rivera-Molina FE., Novick PJ. Only protein-protein interactions imex curation rivera_molina-2009-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rivera-Molina FE., Novick PJ. DIP original experiment: DIP-134437X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A Rab GAP cascade defines the boundary between two Rab GTPases on the secretory pathway. Rivera-Molina FE., Novick PJ. Only protein-protein interactions imex curation rivera_molina-2009-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Rivera-Molina FE., Novick PJ. DIP original experiment: DIP-134440X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A Rab GAP cascade defines the boundary between two Rab GTPases on the secretory pathway. Rivera-Molina FE., Novick PJ. Only protein-protein interactions imex curation rivera_molina-2009-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Rivera-Molina FE., Novick PJ. DIP original experiment: DIP-134438X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A Rab GAP cascade defines the boundary between two Rab GTPases on the secretory pathway. Rivera-Molina FE., Novick PJ. Only protein-protein interactions imex curation ypt31_yeast GTP-binding protein YPT31/YPT8 Rab GTPase YPT31 YPT31 YPT8 YER031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC EC274E5873138D78 gyp1_yeast GTPase-activating protein GYP1 GYP1 YOR070C YOR29-21 GAP for YPT1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGVRSAAKEMHERDHNSDSSSLVTSLMKSWRISSASSSKKPSLYKMNTTESTSLPSGYASSADRDRRTSDGNFEAMAKQQASTRRTSNSYSPLRYVNPTLSTASNESPRPALLLRQHHQRHHHHQQPRHSSSGSVGNNCSNSTEPNKKGDRYFKDLDEDWSAVIDDYNMPIPILTNGGFGTPVAPTRTLSRKSTSSSINSISNMGTSAVRNSSSSFTYPQLPQLQKEKTNDSKKTQLEIENERDVQELNSIIQRISKFDNILKDKTIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVEIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSQEVTSSYSMSSNDIKPPVTPTEPRVASFVTPTKDFQSPTTALSNMTPNNAVEDSGKMRQSSLNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYKDATSHWL 08C1A26B6ED37E13 ypt32_yeast GTP-binding protein YPT32/YPT11 Rab GTPase YPT32 YPT32 YPT11 YGL210W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC 621217A296161964 ypt31-gyp1-1 3194888 N/A 3194892 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3194893 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ypt32-gyp1-1 3194889 N/A 3194894 unspecified role unspecified role bait bait P51996:p.Ser27Asn S27N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3194893 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false gyp1-ypt32-1 3194890 N/A 3194894 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3194893 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gyp1-ypt32-2 3194891 N/A 3194894 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3194893 unspecified role unspecified role bait bait Region 1-210 Region 1-210 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false