IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ eagle-2009-1 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Eagle RA., Traherne JA., Hair JR., Jafferji I., Trowsdale J. NKG2D-Fc species of origin and details found from pmid:12694635 -Reyburn H., donor of the construct is co-author. ULBP6 extracellular domains are not given here nor in ref44. Putative residue numbering has been entered as given for R+D human ULBP-6/RAET1L protein. UL16-Fc -donor of the construct is also Reyburn H. (see PMID:16920952 and PMID:23625227) rob.eagle@gmail.com European journal of immunology 2009 imex curation Only protein-protein interactions imex curation eagle-2009-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Eagle RA., Traherne JA., Hair JR., Jafferji I., Trowsdale J. UL16-GFP found from PMID:16548884; L. Boyle, donor of construct is a co-author. rob.eagle@gmail.com European journal of immunology 2009 imex curation Only protein-protein interactions imex curation ulbp6_human UL16-binding protein 6 Retinoic acid early transcript 1L protein ULBP6 RAET1L protein protein human Homo sapiens Human MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV rae1e_human Retinoic acid early transcript 1E NKG2D ligand 4 Lymphocyte effector toxicity activation ligand RAE-1-like transcript 4 UL16-binding protein 4 RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS ulbp5_human UL-16 binding protein 5 Retinoic acid early transcript 1G protein ULBP5 RAET1G protein protein human Homo sapiens Human MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS ul16p_hcmva Protein UL16 UL16 protein protein hcmva Human cytomegalovirus (strain AD169) (HHV-5) Human herpesvirus 5 HHV-5 MERRRGTVPLGWVFFVLCLSASSSCAVDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYPRPPGSGLAKHPSVSADEELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIRLPHRYQRLRTED klrk1-raet1l-3 3039498 N/A 3039500 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind range range range range false arg26gly,met85thr,leu106arg,thr147ile variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminal_Mus_Ig_Kappa_leader tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_human_PDGFR_transmembrane domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast N/A 3039501 unspecified role unspecified role neutral component neutral component c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 3C alleles ULBP6:03 and variant ULBP6:01 both bind. dbSNP:rs1543547, dbSNP:rs912565, dbSNP:rs1555696, dbSNP:2282236 klrk1-raet1l-2 3039498 N/A 3039502 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminal_Mus_Ig_Kappa_leader tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_human_PDGFR_transmembrane domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast N/A 3039501 unspecified role unspecified role neutral component neutral component c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 3C-2 klrk1-raet1e-5 3039498 N/A 3039503 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminal_Mus_Ig_Kappa_leader tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_human_PDGFR_transmembrane domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast N/A 3039501 unspecified role unspecified role neutral component neutral component c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 3C-3 weak binding klrk1-raet1l-4 3039498 N/A 3039504 unspecified role unspecified role neutral component neutral component signal+ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3039500 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind range range range range false arg26gly,met85thr,leu106arg,thr147ile variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminal_Mus_Ig_Kappa_leader tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_human_PDGFR_transmembrane domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast physical association physical association false false false 5B alleles ULBP6:03 and variant ULBP6:01 both bind. dbSNP:rs1543547, dbSNP:rs912565, dbSNP:rs1555696, dbSNP:2282236 raet1l-ul16-1 3039498 N/A 3039504 unspecified role unspecified role neutral component neutral component signal+ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3039503 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminal_Mus_Ig_Kappa_leader tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminal_human_PDGFR_transmembrane domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast physical association physical association false false false 5B-2 raet1l-ul16-2 3039499 N/A 3039504 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3039500 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 5C ULBP6 allele *03