DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gonzales-2009-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gonzales EB., Kawate T., Gouaux E. DIP original experiment: DIP-219527X Nature 2009 IMEx Pore architecture and ion sites in acid-sensing ion channels and P2X receptors. Gonzales EB., Kawate T., Gouaux E. Only protein-protein interactions imex curation gonzales-2009-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gonzales EB., Kawate T., Gouaux E. DIP original experiment: DIP-219528X Nature 2009 IMEx Pore architecture and ion sites in acid-sensing ion channels and P2X receptors. Gonzales EB., Kawate T., Gouaux E. Only protein-protein interactions imex curation asic1_chick Acid-sensing ion channel 1 ASIC1 ACCN2 Amiloride-sensitive cation channel 2, neuronal protein protein chick Gallus gallus (Chicken) Chicken MMDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTDKGVALSMDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC asic1-5 3194527 N/A 3194529 unspecified role unspecified role unspecified role unspecified role Region 2-466 Region 2-466 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false asic1-6 3194528 N/A 3194529 unspecified role unspecified role unspecified role unspecified role Region 2-466 Region 2-466 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false