DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yazdanpanah-2009-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254315X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254306X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254311X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254313X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254307X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254309X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-7 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254314X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254312X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-9 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254308X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation yazdanpanah-2009-10 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. DIP original experiment: DIP-254310X Nature 2009 IMEx Riboflavin kinase couples TNF receptor 1 to NADPH oxidase. Yazdanpanah B., Wiegmann K., Tchikov V., Krut O., Pongratz C., Schramm M., Kleinridders A., Wunderlich T., Kashkar H., Utermöhlen O., Brüning JC., Schütze S., Krönke M. Only protein-protein interactions imex curation p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL mint cy24b_human Cytochrome b-245 heavy chain CYBB NOX2 CGD91-phox Cytochrome b(558) subunit beta Heme-binding membrane glycoprotein gp91phox NADPH oxidase 2 Neutrophil cytochrome b 91 kDa polypeptide Superoxide-generating NADPH oxidase heavy chain subunit gp91-1 gp91-phox p22 phagocyte B-cytochrome protein protein human Homo sapiens Human MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF nox1_human NADPH oxidase 1 NOX1 MOX1 NOH1 Mitogenic oxidase 1 NADH/NADPH mitogenic oxidase subunit P65-MOX NOH-1 protein protein human Homo sapiens Human MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF cy24a_human Cytochrome b-245 light chain p22 phagocyte B-cytochrome Neutrophil cytochrome b 22 kDa polypeptide p22-phox Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Superoxide-generating NADPH oxidase light chain subunit CYBA protein protein human Homo sapiens Human MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV rifk_human Riboflavin kinase ATP:riboflavin 5'-phosphotransferase Flavokinase RFK protein protein human Homo sapiens Human MRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKEDNFFQVSKSKIMNGH tnr1a_human Tumor necrosis factor receptor superfamily member 1A TNFRSF1A TNFAR TNFR1 p60 Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 protein protein human Homo sapiens Human MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR p19438-1 Tumor necrosis factor receptor superfamily member 1A Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 p60 FL-TNFR1 TNFRSF1A TNFAR TNFR1 protein protein human Homo sapiens Human MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR tnr1a_mouse Tumor necrosis factor receptor superfamily member 1A p60 Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 Tnfrsf1a Tnfr1 Tnfr-1 protein protein mouse Mus musculus Mouse MGLPTVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTAVLLPLVILLGLCLLSFIFISLMCRYPRWRPEVYSIICRDPVPVKEEKAGKPLTPAPSPAFSPTSGFNPTLGFSTPGFSSPVSSTPISPIFGPSNWHFMPPVSEVVPTQGADPLLYESLCSVPAPTSVQKWEDSAHPQRPDNADLAILYAVVDGVPPARWKEFMRFMGLSEHEIERLEMQNGRCLREAQYSMLEAWRRRTPRHEDTLEVVGLVLSKMNLAGCLENILEALRNPAPSSTTRLPR tradd_mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein Tradd TNFRSF1A-associated via death domain protein protein mouse Mus musculus Mouse MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA rifk_mouse Riboflavin kinase Rfk ATP:riboflavin 5'-phosphotransferase Flavokinase KOI-4 protein protein mouse Mus musculus Mouse MRSLPFFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADVSTGIYYGWASVGSGDVHKMVVSIGWNPYYKNVKKSMETHIIHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKQLDLPEHLKLKDDNFFQVSKGKIMNGH tradd_human Tumor necrosis factor receptor type 1-associated DEATH domain protein TRADD TNFRSF1A-associated via death domain protein protein human Homo sapiens Human MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA cy24a_mouse Cytochrome b-245 light chain Cyba Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Neutrophil cytochrome b 22 kDa polypeptide Superoxide-generating NADPH oxidase light chain subunit p22 phagocyte B-cytochrome p22-phox protein protein mouse Mus musculus Mouse MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKKGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGPQVNPMPVTDEVV tnfrsf1a-cyba-1 3194454 N/A 3194464 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194465 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194466 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194467 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194468 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194469 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false tnfrsf1a-rfk-1 3194455 N/A 3194468 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3194470 unspecified role unspecified role bait bait Region 331-363 Region 331-363 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tnfrsf1a-rfk-2 3194456 N/A 3194471 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3194472 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3194473 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false cyba-1 3194457 N/A 3194467 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194474 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194468 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194469 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false tnfrsf1a-rfk-3 3194458 N/A 3194468 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3194470 unspecified role unspecified role bait bait Region 331-363 Region 331-363 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tnfrsf1a-rfk-4 3194459 N/A 3194468 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194469 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false rfk-cyba-1 3194460 N/A 3194475 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3194473 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false tnfrsf1a-rfk-5 3194461 N/A 3194474 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194468 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194469 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false rfk-cyba-2 3194462 N/A 3194467 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194468 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3194469 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false rfk-tradd-1 3194463 N/A 3194472 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3194473 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false