DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ meyer_schaller-2009-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260372X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260374X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260378X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260381X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260379X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260382X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260375X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260380X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260383X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260373X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-11 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260376X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260384X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation meyer_schaller-2009-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. DIP original experiment: DIP-260377X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The human Dcn1-like protein DCNL3 promotes Cul3 neddylation at membranes. Meyer-Schaller N., Chou YC., Sumara I., Martin DD., Kurz T., Katheder N., Hofmann K., Berthiaume LG., Sicheri F., Peter M. Only protein-protein interactions imex curation cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA cul4b_human Cullin-4B CUL4B KIAA0695 protein protein human Homo sapiens Human MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA cul4a_human Cullin-4A CUL4A protein protein human Homo sapiens Human MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA cul3_human Cullin-3 CUL3 KIAA0617 protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA dcnl1_human DCN1-like protein 1 DCUN1D1 DCUN1L1 RP42 SCCRO Defective in cullin neddylation protein 1-like protein 1 DCUN1 domain-containing protein 1 Squamous cell carcinoma-related oncogene DCN1 protein protein human Homo sapiens Human MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV dcnl3_human DCN1-like protein 3 DCUN1D3 SCCRO3 DCUN1 domain-containing protein 3 Defective in cullin neddylation protein 1-like protein 3 Squamous cell carcinoma-related oncogene 3 protein protein human Homo sapiens Human MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPTSSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKREGEGRGALSSGPEGLCPEEQT q13618-1 Cullin-3 CUL3 KIAA0617 Cul-3 Long protein protein human Homo sapiens Human MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA ubc12_human NEDD8-conjugating enzyme Ubc12 UBE2M UBC12 Ubiquitin-conjugating enzyme E2 M NEDD8 carrier protein protein protein human Homo sapiens Human MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK dcnl2_human DCN1-like protein 2 C13orf17 DCUN1 domain-containing protein 2 DCUN1L2 Defective in cullin neddylation protein 1-like protein 2 DCUN1D2 protein protein human Homo sapiens Human MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH dcun1d1-cul1-1 3194065 N/A 3194078 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194079 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194080 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194081 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194082 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194083 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194084 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false dcun1d3-cul1-1 3194066 N/A 3194081 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194082 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194083 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194085 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false dcun1d3-cul3-1 3194067 N/A 3194081 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194085 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q8IWE4:p.[Asp241Ala;Ala265Arg;Asp271Ala] D241A/A265R/D271A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false dcun1d1-cul1-2 3194068 N/A 3194079 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194080 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194081 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194082 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194083 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194084 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false cul3-dcun1d3-1 3194069 N/A 3194086 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3194085 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false dcun1d1-ube2m-1 3194070 N/A 3194087 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194084 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false dcun1d3-cul3-2 3194071 N/A 3194086 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q13618-1:p.Arg756Ala R756A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3194085 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false cul3-dcun1d1-1 3194072 N/A 3194084 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3194086 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3194085 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false dcun1d2-ube2m-1 3194073 N/A 3194088 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3194087 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false dcun1d2-cul1-1 3194074 N/A 3194078 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194079 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194080 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194081 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194082 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194083 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3194088 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false ube2m-dcun1d3-1 3194075 N/A 3194085 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3194087 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false cul3-cul3-1 3194076 N/A 3194086 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3194086 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false cul3-rbx1-1 3194077 N/A 3194086 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3194089 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false