DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ camberg-2009-1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Camberg JL., Hoskins JR., Wickner S. DIP original experiment: DIP-260333X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ClpXP protease degrades the cytoskeletal protein, FtsZ, and modulates FtsZ polymer dynamics. Camberg JL., Hoskins JR., Wickner S. Only protein-protein interactions imex curation camberg-2009-2 in vitro In vitro filter trap assay filter trap assay Filter retention assay Filter retention assay predetermined predetermined participant predetermined Camberg JL., Hoskins JR., Wickner S. DIP original experiment: DIP-260334X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ClpXP protease degrades the cytoskeletal protein, FtsZ, and modulates FtsZ polymer dynamics. Camberg JL., Hoskins JR., Wickner S. Only protein-protein interactions imex curation camberg-2009-3 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Camberg JL., Hoskins JR., Wickner S. DIP original experiment: DIP-260335X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ClpXP protease degrades the cytoskeletal protein, FtsZ, and modulates FtsZ polymer dynamics. Camberg JL., Hoskins JR., Wickner S. Only protein-protein interactions imex curation clpx_ecoli ATP-dependent Clp protease ATP-binding subunit ClpX clpX lopC b0438 JW0428 ATP-dependent unfoldase ClpX protein protein ecoli Escherichia coli (strain K12) MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKASEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVIDESVIDGQSKPLLIYGKPEAQQASGE ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD clpx-ftsz-1 3193125 N/A 3193128 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3193129 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false clpx-ftsz-2 3193126 N/A 3193128 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3193129 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ftsz-1 3193127 N/A 3193129 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false