DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dezwaan-2009-1 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie DeZwaan DC., Toogun OA., Echtenkamp FJ., Freeman BC. DIP original experiment: DIP-133088X Nature structural & molecular biology 2009 IMEx The Hsp82 molecular chaperone promotes a switch between unextendable and extendable telomere states. DeZwaan DC., Toogun OA., Echtenkamp FJ., Freeman BC. Only protein-protein interactions imex curation dezwaan-2009-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined DeZwaan DC., Toogun OA., Echtenkamp FJ., Freeman BC. DIP original experiment: DIP-133089X Nature structural & molecular biology 2009 IMEx The Hsp82 molecular chaperone promotes a switch between unextendable and extendable telomere states. DeZwaan DC., Toogun OA., Echtenkamp FJ., Freeman BC. Only protein-protein interactions imex curation ten1_yeast Telomere length regulation protein TEN1 TEN1 Protein telomeric pathways with STN1 YLR010C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQLVLDLKCLKDKIATNYDIHNNVYGGNGMEPNIIHPSKRFRIVVRLVDFLFCKSDEEFIKGFFCQMIVRNLHCLNSTNGAEEMRLYMSERLFSAHKDDLRLINGQVLDVRIGVWYGIHQSPPIFEIIDFKILSRNDVRDFCEFVKSPLGEKFLNISNS 0D8152451821E2CE stn1_yeast Protein STN1 STN1 D4456 YD8554.15 YDR082W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDKYGHIAHQEGDVCYYIPRLFKYNSYYSGTEDVRIFVGDLKYRMRVSLQICEKYYDRRLSMLFWKNHPLQQIHLIGCIIGLQFKWIGKQEYIFFQLDDCTSDSSLVGYTSDMRFLTCKVKKDSILSWGLNITDLIGLTLHVYGQASLNYQELQVEYLRLCYSLTEEIDHWKITMNMREQLDTPWSLSDFVIGELFTQEQEWTPETSQIEVVNPDFVGIGYKTPESKRNETTFIEQLQEERLKDELEIISPYNSTDTSNSVHSLSFRFVSSLKDFPETHFLNSGDQIDNGNDEQLKKLEYQSANLPVMIPNRTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDPKNGMEDQNSGILLHLEYAAAYS 61B691C8D4A2E650 stn1-ten1-7 3192822 N/A 3192824 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3192825 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false stn1-ten1-8 3192823 N/A 3192824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3192825 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false