DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lunelli-2009-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260302X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260304X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260307X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260310X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-5 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260305X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-6 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260308X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-7 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260303X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260309X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-9 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260311X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation lunelli-2009-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. DIP original experiment: DIP-260306X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx IpaB-IpgC interaction defines binding motif for type III secretion translocator. Lunelli M., Lokareddy RK., Zychlinsky A., Kolbe M. Only protein-protein interactions imex curation ipab_shifl Invasin IpaB 62 kDa antigen ipaB CP0128 protein protein shifl Shigella flexneri MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA ipgc_shifl Chaperone protein IpgC ipgC ippI CP0129 protein protein shifl Shigella flexneri MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE o87496_yeren sycD protein protein YEREN_W22703 Yersinia enterocolitica W22703 MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHECVDNP yopb_yeren Protein YopB yopB protein protein yeren Yersinia enterocolitica MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASKIFGWLIAIASVVIGAIMVASGVGAVAGAMMIASGVIGMANMAVKQAAEDGLISQEAMQVLGPILTAIEVALTVVSTVMTFGGSALKCLADIGAKLGANTASLAAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFGSLTMSHVIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHRQVMELIFQMINAKGDMLHNLAGRPHTV sica_salty Chaperone protein SicA sicA spaT STM2886 Salmonella invasin chaperone protein protein salty Salmonella typhimurium MDYQNNVSEERVAEMIWDAVSEGATLKDVHGIPQDMMDGLYAHAYEFYNQGRLDEAETFFRFLCIYDFYNPDYTMGLAAVCQLKKQFQKACDLYAVAFTLLKNDYRPVFFTGQCQLLMRKAAKARQCFELVNERTEDESLRAKALVYLEALKTAETEQHSEQEKE yopd_yeren Protein YopD yopD protein protein yeren Yersinia enterocolitica MTINIKTDSPIITTGSQLDAITTETVGQSGEVKKTEDTRHEAQAIKSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQRDIENKATISAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQILNSNIAGRDQLIDTKMQQMSNAGDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDSKANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFMKDVLRLIEQYVSSHTHAMKAAFGVV ipab-ipgc-1 3191560 N/A 3191570 unspecified role unspecified role unspecified role unspecified role Region 51-72 Region 51-72 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3191571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ipgc-1 3191561 N/A 3191571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ipgc-2 3191562 N/A 3191571 unspecified role unspecified role unspecified role unspecified role P0A2U4:p.[Ala94Glu;Val95Gln] A94E/V95Q mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sycd-yopb-1 3191563 N/A 3191572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3191573 unspecified role unspecified role unspecified role unspecified role Region 50-55 Region 50-55 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false ipgc-3 3191564 N/A 3191571 unspecified role unspecified role unspecified role unspecified role P0A2U4:p.[Ala94Glu;Val95Gln] A94E/V95Q mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sica-1 3191565 N/A 3191574 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ipab-ipgc-2 3191566 N/A 3191570 unspecified role unspecified role unspecified role unspecified role Region 65-70 Region 65-70 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P18011:p.Pro70Asp P70D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P18011:p.Leu67Asn L67N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P18011:p.Pro65Arg P65R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P18011:p.Lys68Ala K68A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3191571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ipab-ipgc-3 3191567 N/A 3191570 unspecified role unspecified role unspecified role unspecified role Region 65-70 Region 65-70 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3191571 unspecified role unspecified role unspecified role unspecified role P0A2U4:p.[Ser41Met;Tyr44Gly;Gly75Gln;Ala78Met] S41M/Y44G/G75Q/A78M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sycd-yopd-1 3191568 N/A 3191572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3191575 unspecified role unspecified role unspecified role unspecified role Region 58-63 Region 58-63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false sica-2 3191569 N/A 3191574 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false