IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rybarska-2009-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de C.elegans cDNA PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-3 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down western blot western blot Immuno blot Immuno blot Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de C.elegans cDNA PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-6 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-8 caeel Caenorhabditis elegans confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de PLoS genetics 2009 imex curation Only protein-protein interactions rybarska-2009-7 caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR., Rybarska A., Harterink M., Jedamzik B., Kupinski AP., Schmid M., Eckmann CR. Isoform 3 of gls-1 has had 3 amino acids removed from the N-terminus by UniProtKB/Swiss-Prot who report a wrong initiator site. Numbering for this construct has been changed accordingly. eckmann@mpi-cbg.de PLoS genetics 2009 imex curation Only protein-protein interactions q8i4m5-3 Germline survival defective-1 gls-1 C36B1.8 protein protein caeel Caenorhabditis elegans MANKKNHQQKKSTDGSTMNGNNATATAAATTQNSSQIGQNSNSSHSVTNDNTSSNNASTSTSSITSTTTTTTTVPSSQQSQSQNQYSHQRLSSTSSTSQQTGISKFPAKKAGHNELEKTSNTANSQSGAFKGTTNKDRPKEKEKNTHSGNRQSQVNHNHHHSNHVSGNQQNRKNKNRDHSNQSYRGGYTHNHNNYHSLENAKSSGFLSNSSLSSAGQISASSAPPVSTTPTAIPIFQESKIVQTDPPVEEAKKKKEKPKIKRDEEPMPYKSTDPKNMDSVMAFKEHDEWDKVEFMCELVSFLSPTDLRLLGNCIEGSVRCYNNQMRPVEKTSNCSDPTAGLPQFVCSPPPPPQQVYYFPGIADAALYQTRNAVNSVFVQQHPPGLPPLLGGMQNIMYPPDANFHHSTSCTTPSSSVSVANKDVNNVPVVLSSSVNGISNNIPSDRQQLDSKPNTARGSSGNINQSNTTSPEPEPGSNHISTTAANPAHPTSVTVPQSVPPVPQEPELFLKSVLDLTSYIYTLMAVCSSTNRKSAAKISDYVQNVILREKSQILERIPDELDKITVLQEIGKIVAAMTHHPAITLDDKMKYAALRDGLRAQIETLFRQYYTTQKQLEQSNLVVPSSQAVGDENDTDSDHESEEEFEPLSGVMGSRFESNPVQPSPSVPGTFFIIRFIGRQIEKNDNLFSLEIHWSDGDRTFAQRSRDQLKALQHRLLDEFGQQRSEKYLHQGCTTSYSSFDDDNKKLSASTSTMETFAPNGERIVPRLARDATPAQYVQYINELSDLPARMMLSAVICEEFNGTRAKTEDLLQETREASDGLIYSRWKNPRAKSPVRYFKRNATGSIDPIELPVNMQPFLYSNIPQTQVQTLFPSCSNCGGPHAPKHCEKQTLLSKKGDHRTRSDGEGSQQNGGTSSSNSYAPIHANLPHAVYIENPQAMLGSNHFNHHQQQHIIQNTIFHNGGQFRANGTYEPQIPIAYYHAQGTVQNSNNTGGVNGNSGGGNQNSNF q95zk7-1 Defective in germ line development protein 3 T07F8.3 GLD-3L Germline development defective 3 gld-3 protein protein caeel Caenorhabditis elegans MGEQSHEKDHDEAHSYNPFVRSAVEYDADTRLQMAENAASARKLFVSSALKDIIVNPENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQLKAQGLPLPSNIPMIEINPTRVTLNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRARMLMRRNCHFTVFMALSKMKMPLHELQAHVRQNPIQNVEMSFVDAPEKNGIVTTYLRITAREKNQHELIEAAKRLNEILFRESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTIISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHMIIDESGIILKMTPSVYEPADLLSGEVPLNCASLRSKEFNIKKLYTAYQKVLSKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSKGKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPPMLTPHHHMLKYVYLQQHQQAQTFLKGAAGLHPGTHIMFPPPIIVDGSFVSALPFADPVVFDGFPYVHGLFPVNEAEQHRNHRESSPSLRSTQEIRKPSRNMGNRPSSSTGSYYPSTTPRQRVYEQVREDDLRSHIGSRRTSVNGDDQNVESMHDQGYERQYPRQHQRLQKDDQQRWKTGSRGDIHSSRTINVHRDVRNSNEYDFHVGNSGPAKRSPSLEQVQLQMTHHLKLKSNDVDLDHEKLYMHESPHNDSDTTVSASGFGNDLMDGDFVQRFLSNANINESGRRPRTVSCFTEKDGQSARYIDSDGAYSVVDHASTHQSRSYDSFRKVGDNGVTKTILEPRARVEKDYGKISLEHKTKYSNEYGDEEKSAENDTSSLGSRQYRIDPMKLIASVRESSEQLPRIHERQFSDVLNEKEKEIADKSIESTVTQDLSLDETSTY q95zk7-2 Defective in germ line development protein 3 Germline development defective 3 T07F8.3 GLD-3S gld-3 protein protein caeel Caenorhabditis elegans MGEQSHEKDHDEAHSYNPFVRSAVEYDADTRLQMAENAASARKLFVSSALKDIIVNPENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQLKAQGLPLPSNIPMIEINPTRVTLNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRARMLMRRNCHFTVFMALSKMKMPLHELQAHVRQNPIQNVEMSFVDAPEKNGIVTTYLRITAREKNQHELIEAAKRLNEILFRESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTIISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHMIIDESGIILKMTPSVYEPADLLSGEVPLNCASLRSKEFNIKKLYTAYQKVLSKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSKGKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPPMLTPHHHMLKYVYLQQHQQAQTFLKGAAGLHPGTHIMFPPPIIVDGSFGARYSSNIYPFSYIVPQNFNFLNGNFGHLKLKSNDVDLDHEKLYMHESPHNDSDTTVSASGFGNDLMDGDFVQRFLSNANINESGRRPRTVSCFTEKDGQSARYIDSDGAYSVVDHASTHQSRSYDSFRKVGDNGVTKTILEPRARVEKDYGKISLEHKTKYSNEYGDEEKSAENDTSSLGSRQYRIDPMKLIASVRESSEQLPRIHERQFSDVLNEKEKEIADKSIESTVTQDLSLDETSTY fbf2_caeel Fem-3 mRNA-binding factor 2 fbf-2 F21H12.5 protein protein caeel Caenorhabditis elegans MDQSKMRRTNQFRKTSQKPPSTGIDSYPTPAQSPMAQHETPMWDFNSLNPYFSMLNMNDGINYARHQQNHIVTSRPPTPLTDLMSLRSFQSFPNVFMPVSRSRTSSFIQSDTDSSRLESDDFSQNVRCFSADIDRSKSYGSSKHYHLKYSRPALSRNSRSFTRSNNVLPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYLVQSVIGISLATNDDGYTKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICSDKYGCRVVQTIIEKLTADSMNVDLTSAAQNLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPLELLAEMMDEIFDGYIPHPDTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGGYDHAISFQDWLKKLHSRVTKERHRLSRFSSGKKMIETLANLRSTHPIYELQSSGHDSFKTDYFSTASEHDGPELEKNGIEEGSLMLEPRSNKSSVSVKFSSSGSHGDD mint Involved in the control of stem cells and sex determination in the C.elegans hermaphrodite germline. Binds specifically to the regulatory region of fem-3 3'-UTR and mediates the sperm/oocyte switch fbf1_caeel Fem-3 mRNA-binding factor 1 fbf-1 H12I13.4 protein protein caeel Caenorhabditis elegans MDQSKMRYTNQFRKTPQKPTSTEVGNHHTPAHSPMAQHETSMWNFNSLNPYFSMLNMNDGMNYARHQQNHIVTSRPPTPLTDLMSLRSFQSFPNVFMPVSRSRTSSFIQSDTDSSRLEPDDFSQNVRYCSTEIDRNNSSSKNDHLKYSRPALSRNSRSFTRSNNVLPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYFVQEIIGMSLTTYDDDNIKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICFDKYGCRVVQTIIEKLTADSINVDLTSAAQHLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPMELLAEMMDEIFDGYMPHPGTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGSYDHANSFQVWLKKLHSRVTKERHRLSRFSSGKKMIETLAHLRSTHPIYGLQSSGHESFKTDCFSTASEHDGLELEKNGIEEGNLRLMRTFSP gls1_caeel Germline survival defective-1 C36B1.8 gls-1 protein protein caeel Caenorhabditis elegans MRCLISYLFHSFLIFLKFIRSDVTALTLQEKRKKSRLTGILMKSMANKKNHQQKKSTDGSTMNGNNATATAAATTQNSSQIGQNSNSSHSVTNDNTSSNNASTSTSSITSTTTTTTTVPSSQQSQSQNQYSHQRLSSTSSTSQQTGISKFPAKKAGHNELEKTSNTANSQSGAFKGTTNKDRPKEKEKNTHSGNRQSQVNHNHHHSNHVSGNQQNRKNKNRDHSNQSYRGGYTHNHNNYHSLENAKSSGFLSNSSLSSAGQISASSAPPVSTTPTAIPIFQESKIVQTDPPVEEAKKKKEKPKIKRDEEPMPYKSTDPKNMDSVMAFKEHDEWDKVEFMCELVSFLSPTDLRLLGNCIEGSVRCYNNQMRPVEKTSNCSDPTAGLPQFVCSPPPPPQQVYYFPGIADAALYQTRNAVNSVFVQQHPPGLPPLLGGMQNIMYPPDANFHHSTSCTTPSSSVSVANKDVNNVPVVLSSSVNGISNNIPSDRQQLDSKPNTARGSSGNINQSNTTSPEPEPGSNHISTTAANPAHPTSVTVPQSVPPVPQEPELFLKSVLDLTSYIYTLMAVCSSTNRKSAAKISDYVQNVILREKSQILERIPDELDKITVLQEIGKIVAAMTHHPAITLDDKMKYAALRDGLRAQIETLFRQYYTTQKQLEQSNLVVPSSQAVGDENDTDSDHESEEEFEPLSGVMGSRFESNPVQPSPSVPGTFFIIRFIGRQIEKNDNLFSLEIHWSDGDRTFAQRSRDQLKALQHRLLDEFGQQRSEKYLHQGCTTSYSSFDDDNKKLSASTSTMETFAPNGERIVPRLARDATPAQYVQYINELSDLPARMMLSAVICEEFNGTRAKTEDLLQETREASDGLIYSRWKNPRAKSPVRYFKRNATGSIDPIELPVNMQPFLYSNIPQTQVQTLFPSCSNCGGPHAPKHCEKQTLLSKKGDHRTRSDGEGSQQNGGTSSSNSYAPIHANLPHAVYIENPQAMLGSNHFNHHQQQHIIQNTIFHNGGQFRANGTYEPQIPIAYYHAQGTVQNSNNTGGVNGNSGGGNQNSNF gld3_caeel Defective in germ line development protein 3 gld-3 Germline development defective 3 T07F8.3 protein protein caeel Caenorhabditis elegans MGEQSHEKDHDEAHSYNPFVRSAVEYDADTRLQMAENAASARKLFVSSALKDIIVNPENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQLKAQGLPLPSNIPMIEINPTRVTLNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRARMLMRRNCHFTVFMALSKMKMPLHELQAHVRQNPIQNVEMSFVDAPEKNGIVTTYLRITAREKNQHELIEAAKRLNEILFRESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTIISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHMIIDESGIILKMTPSVYEPADLLSGEVPLNCASLRSKEFNIKKLYTAYQKVLSKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSKGKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPPMLTPHHHMLKYVYLQQHQQAQTFLKGAAGLHPGTHIMFPPPIIVDGSFVSALPFADPVVFDGFPYVHGLFPVNEAEQHRNHRESSPSLRSTQEIRKPSRNMGNRPSSSTGSYYPSTTPRQRVYEQVREDDLRSHIGSRRTSVNGDDQNVESMHDQGYERQYPRQHQRLQKDDQQRWKTGSRGDIHSSRTINVHRDVRNSNEYDFHVGNSGPAKRSPSLEQVQLQMTHHLKLKSNDVDLDHEKLYMHESPHNDSDTTVSASGFGNDLMDGDFVQRFLSNANINESGRRPRTVSCFTEKDGQSARYIDSDGAYSVVDHASTHQSRSYDSFRKVGDNGVTKTILEPRARVEKDYGKISLEHKTKYSNEYGDEEKSAENDTSSLGSRQYRIDPMKLIASVRESSEQLPRIHERQFSDVLNEKEKEIADKSIESTVTQDLSLDETSTY gls_1-gld_3-3 2972629 N/A 2972637 unspecified role unspecified role prey prey N/A 2972638 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3A, 3D gld_3-gls_1-6 2972629 N/A 2972637 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2972638 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3A, 3E gld_3-gls_1-7 2972629 N/A 2972637 unspecified role unspecified role prey prey N/A 2972639 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3A gld_3-fbf_2-1 2972629 N/A 2972640 unspecified role unspecified role prey prey N/A 2972638 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3A gls_1-gld_3-4 2972629 N/A 2972637 unspecified role unspecified role bait bait N/A 2972638 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3A gld_3-gls_1-2 2972630 N/A 2972638 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2972637 unspecified role unspecified role prey prey purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false Fig. 5F The N-terminal KH domain region of GLD-3 also bound very weakly to GLS-1. gld_3-gls_1-5 2972630 N/A 2972641 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 2972638 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 2972637 competitor competitor competitor prey prey purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false Fig. 5G fbf_1-gld_3-1 2972630 N/A 2972641 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 2972638 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false Fig. 5G gld_3-gls_1-1 2972631 N/A 2972642 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2972638 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supplementary materials gls_1-gld_3-2 2972631 N/A 2972637 unspecified role unspecified role bait bait N/A 2972643 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary materials gld_3-gls_1-4 2972632 N/A 2972642 unspecified role unspecified role prey prey N/A 2972638 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3C gls_1-gld_3-1 2972632 N/A 2972642 unspecified role unspecified role bait bait N/A 2972638 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3C gld_3-gls_1-3 2972633 N/A 2972637 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2972638 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 3B The interaction is not RNA-mediated gld_3-gls_1-8 2972634 N/A 2972637 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 2972638 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q95ZK7-1:p.Gly327Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 7E gld_3-gls_1-9 2972635 N/A 2972642 unspecified role unspecified role neutral component neutral component N/A 2972643 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 2A gld_3-gls_1-10 2972636 N/A 2972642 unspecified role unspecified role neutral component neutral component N/A 2972643 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 2D