IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pang-2009-1 human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Pang AJ., Reithmeier RA. Glycophorin A is stated to be a 131 amino acid protein and it's complete sequence is given in Ref 9, which was published in 1975. The sequence has 98.5% homology to UniProt P02724 isoform 1, amino acids 20-150. (original ID:(GenPept) PRF: 0412211A) r.reithmeier@utoronto.ca The Biochemical journal 2009 imex curation Only protein-protein interactions pang-2009-2 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Pang AJ., Reithmeier RA. Cells were FACS sorted for AE1 expression and stained with BRIC14 antibody- which detects the Wright B blood group antigen (an association of GPA and AE1). Glycophorin A is stated to be a 131 amino acid protein and it's complete sequence is given in Ref 9, which was published in 1975. The sequence has 98.5% homology to UniProt P02724 isoform 1, amino acids 20-150. (original ID:(GenPept) PRF: 0412211A) r.reithmeier@utoronto.ca The Biochemical journal 2009 imex curation Only protein-protein interactions pang-2009-3 human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pang AJ., Reithmeier RA. Cells were FACS sorted for AE1 expression and stained with BRIC14 antibody- which detects the Wright B blood group antigen (an association of GPA and AE1). Glycophorin A is stated to be a 131 amino acid protein and it's complete sequence is given in Ref 9, which was published in 1975. The sequence has 98.5% homology to UniProt P02724 isoform 1, amino acids 20-150. (original ID:(GenPept) PRF: 0412211A) r.reithmeier@utoronto.ca The Biochemical journal 2009 imex curation Only protein-protein interactions b3at_human Band 3 anion transport protein SLC4A1 AE1 DI EPB3 Anion exchange protein 1 Solute carrier family 4 member 1 protein protein human Homo sapiens Human MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEGRDEYDEVAMPV Defects in SLC4A1 are the cause of elliptocytosis type 4 (EL4) [MIM:109270]. EL4 is a Rhesus-unlinked form of hereditary elliptocytosis, a genetically heterogeneous, autosomal dominant hematologic disorder. It is characterized by variable hemolytic anemia and elliptical or oval red cell shape Defects in SLC4A1 are the cause of autosomal dominant distal renal tubular acidosis (dRTA) [MIM:179800]. This disease is characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis Defects in SLC4A1 are the cause of autosomal recessive distal renal tubular acidosis (dRTA) [MIM:611590] Band 3 is the major integral glycoprotein of the erythrocyte membrane. Band 3 has two functional domains. Its integral domain mediates a 1:1 exchange of inorganic anions across the membrane, whereas its cytoplasmic domain provides binding sites for cytoskeletal proteins, glycolytic enzymes, and hemoglobin mint Defects in SLC4A1 are a cause of hereditary spherocytosis (HS) [MIM:109270]. HS is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal glpa_human Glycophorin-A PAS-2 Sialoglycoprotein alpha MN sialoglycoprotein GYPA GPA protein protein human Homo sapiens Human MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ gypa-slc4a1-4 3021234 N/A 3021237 unspecified role unspecified role neutral component neutral component val-557 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain false N/A 3021238 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 5 gypa-slc4a1-3 3021234 N/A 3021237 unspecified role unspecified role neutral component neutral component val557 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain false P02730:p.Arg760Gln mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3021238 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 8A gypa-slc4a1-1 3021235 N/A 3021237 unspecified role unspecified role neutral component neutral component val557 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain false human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells N/A 3021238 unspecified role unspecified role neutral component neutral component human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells physical association physical association false false false Figure 6A gypa-slc4a1-2 3021236 N/A 3021237 unspecified role unspecified role prey prey val557 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain false P02730:p.Arg760Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3021238 unspecified role unspecified role bait bait physical association physical association false false false Figure 7A, 8B