DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mueller-2009-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mueller M., Grauschopf U., Maier T., Glockshuber R., Ban N. DIP original experiment: DIP-249898X Nature 2009 IMEx The structure of a cytolytic alpha-helical toxin pore reveals its assembly mechanism. Mueller M., Grauschopf U., Maier T., Glockshuber R., Ban N. Only protein-protein interactions imex curation mueller-2009-2 in vitro In vitro filter trap assay filter trap assay Filter retention assay Filter retention assay predetermined predetermined participant predetermined Mueller M., Grauschopf U., Maier T., Glockshuber R., Ban N. DIP original experiment: DIP-249899X Nature 2009 IMEx The structure of a cytolytic alpha-helical toxin pore reveals its assembly mechanism. Mueller M., Grauschopf U., Maier T., Glockshuber R., Ban N. Only protein-protein interactions imex curation hlye_ecoli Hemolysin E, chromosomal hlyE clyA hpr sheA Cytotoxin ClyA Hemolysis-inducing protein Latent pore-forming 34 kDa hemolysin Silent hemolysin SheA ycgD JW5181 b1182 protein protein ecoli Escherichia coli (strain K12) MTEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAAAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKRHGKKTLFEVPEV mint hlye-1 3190419 N/A 3190421 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hlye-2 3190420 N/A 3190421 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false