DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2009-26 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134208X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-27 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134203X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-28 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134213X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-29 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134204X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-30 sulsf Sulfolobus solfataricus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134209X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-31 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134210X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-32 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134214X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-33 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134205X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-34 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134215X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-35 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134211X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-36 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134206X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-37 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134216X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-38 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134207X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation zhang-2009-39 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. DIP original experiment: DIP-134212X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Archaeal eukaryote-like Orc1/Cdc6 initiators physically interact with DNA polymerase B1 and regulate its functions. Zhang L., Zhang L., Liu Y., Yang S., Gao C., Gong H., Feng Y., He ZG. Only protein-protein interactions imex curation dpol1_sacs2 DNA polymerase 1 dpo1 DNA polymerase I Pol B1 polS SSO0552 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MTKQLTLFDIPSSKPAKSEQNTQQSQQSAPVEEKKVVRREWLEEAQENKIYFLLQVDYDGKKGKAVCKLFDKETQKIYALYDNTGHKPYFLVDLEPDKVGKIPKIVRDPSFDHIETVSKIDPYTWNKFKLTKIVVRDPLAVRRLRNDVPKAYEAHIKYFNNYMYDIGLIPGMPYVVKNGKLESVYLSLDEKDVEEIKKAFADSDEMTRQMAVDWLPIFETEIPKIKRVAIDIEVYTPVKGRIPDSQKAEFPIISIALAGSDGLKKVLVLNRNDVNEGSVKLDGISVERFNTEYELLGRFFDILLEYPIVLTFNGDDFDLPYIYFRALKLGYFPEEIPIDVAGKDEAKYLAGLHIDLYKFFFNKAVRNYAFEGKYNEYNLDAVAKALLGTSKVKVDTLISFLDVEKLIEYNFRDAEITLQLTTFNNDLTMKLIVLFSRISRLGIEELTRTEISTWVKNLYYWEHRKRNWLIPLKEEILAKSSNIRTSALIKGKGYKGAVVIDPPAGIFFNITVLDFASLYPSIIRTWNLSYETVDIQQCKKPYEVKDETGEVLHIVCMDRPGITAVITGLLRDFRVKIYKKKAKNPNNSEEQKLLYDVVQRAMKVFINATYGVFGAETFPLYAPAVAESVTALGRYVITSTVKKAREEGLTVLYGDTDSLFLLNPPKNSLENIIKWVKTTFNLDLEVDKTYKFVAFSGLKKNYFGVYQDGKVDIKGMLVKKRNTPEFVKKVFNEVKELMISINSPNDVKEIKRKIVDVVKGSYEKLKNKGYNLDELAFKVMLSKPLDAYKKNTPQHVKAALQLRPFGVNVLPRDIIYYVKVRSKDGVKPVQLAKVTEIDAEKYLEALRSTFEQILRAFGVSWDEIAATMSIDSFFSYPSKGNS 77E3ED975AA1C81A cdc63_sacs2 ORC1-type DNA replication protein 3 cdc6-3 SSO2184 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MHVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSISIGDFDDVGEN 437E64B7E82B10B9 cdc61_sacs2 ORC1-type DNA replication protein 1 cdc6-1 SSO0257 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MSDIIDEVISSFKTSSIFINREYLLPDYIPDELPHREDQIRKIASILAPLYREEKPNNIFIYGLTGTGKTAVVKFVLSKLHKKFLGKFKHVYINTRQIDTPYRVLADLLESLDVKVPFTGLSIAELYRRLVKAVRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRINSEVNKSKISFIGITNDVKFVDLLDPRVKSSLSEEEIIFPPYNAEELEDILTKRAQMAFKPGVLPDNVIKLCAALAAREHGDARRALDLLRVSGEIAERMKDTKVKEEYVYMAKEEIERDRVRDIILTLPFHSKLVLMAVVSISSEENVVSTTGAVYETYLNICKKLGVEAVTQRRVSDIINELDMVGILTAKVVNRGRYGKTKEIGLAVDKNIIVRSLIESDSRFADLWS A2A32A355A3ADD74 cdc62_sacs2 ORC1-type DNA replication protein 2 cdc6-2 SSO0771 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MVSAKDILSDSLRSSVLIIKHKDKLSPDYVPENLPHREEKIKELGFIFKDLLAGDAKDSERVVILGRTGTGKTATVRLFGKNFEDIAEREYGVKVKYVHINCYRHRTLYLISQEIANALKLPIPSRGLSAQEVFKMIHEYLDRRNIHLIVALDEFGHFLNTANTEEIYFLVRLYDEISAIIKRISYIFIVNESHSIYKLDRSIRDHIARRLIEFPPYKSMELYDILKYRVDEAFNDNAVDDEVLQFISNTYGYDKGGNGNARIAIETLSLAGEIAEKEGSPVVLLDHAKKANSTINPEIQEIIDSLSYLDLHQLILLKALIRALNKTKADEITMGTLEEEYISLSREFNEEPRRHTQVYEYLRKLKVIGIINTRQSGKGMRGRTTLVSLSLPLDKRLDDYIMQQIMVRLKSRA 3CFFCFF405ACD01C dpo4_sacs2 DNA polymerase IV dbh dpo4 SSO2448 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT C0B0AD4B3A3E87D0 pcna1_sacs2 DNA polymerase sliding clamp 1 pcn1 Proliferating cell nuclear antigen homolog 1 pcnA-like C41_008 SSO0397 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MFKIVYPNAKDFFSFINSITNVTDSIILNFTEDGIFSRHLTEDKVLMAIMRIPKDVLSEYSIDSPTSVKLDVSSVKKILSKASSKKATIELTETDSGLKIIIRDEKSGAKSTIYIKAEKGQVEQLTEPKVNLAVNFTTDESVLNVIAADVTLVGEEMRISTEEDKIKIEAGEEGKRYVAFLMKDKPLKELSIDTSASSSYSAEMFKDAVKGLRGFSAPTMVSFGENLPMKIDVEAVSGGHMIFWIAPRL 137EB10BE2C03F77 ssopolb1-ssocdc6_3-1 3190313 N/A 3190327 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3190328 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_1-1 3190314 N/A 3190327 unspecified role unspecified role bait bait Region 467-882 Region 467-882 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3190329 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false ssocdc6_2-ssopolb1-1 3190315 N/A 3190330 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3190327 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_2-1 3190316 N/A 3190330 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190327 unspecified role unspecified role bait bait Region 467-882 Region 467-882 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_2-2 3190317 N/A 3190330 unspecified role unspecified role prey prey sulsf Sulfolobus solfataricus N/A 3190327 unspecified role unspecified role bait bait sulsf Sulfolobus solfataricus physical association physical association false false false ssopolb1-ssocdc6_1-2 3190318 N/A 3190327 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3190329 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssopoly-1 3190319 N/A 3190331 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190327 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_3-2 3190320 N/A 3190327 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3190328 unspecified role unspecified role prey prey Region 467-882 Region 467-882 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false ssocdc6_3-ssopolb1-1 3190321 N/A 3190327 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190328 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ssocdc6_1-ssopolb1-1 3190322 N/A 3190327 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190329 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_1-3 3190323 N/A 3190327 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3190329 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false ssopcna2-ssopolb1-1 3190324 N/A 3190327 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190332 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_2-3 3190325 N/A 3190330 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190327 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false ssopolb1-ssocdc6_2-4 3190326 N/A 3190330 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3190327 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false