DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sanz-2009-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sanz C., Rodríguez-Romero J., Idnurm A., Christie JM., Heitman J., Corrochano LM., Eslava AP. DIP original experiment: DIP-134173X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Phycomyces MADB interacts with MADA to form the primary photoreceptor complex for fungal phototropism. Sanz C., Rodríguez-Romero J., Idnurm A., Christie JM., Heitman J., Corrochano LM., Eslava AP. Only protein-protein interactions imex curation sanz-2009-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sanz C., Rodríguez-Romero J., Idnurm A., Christie JM., Heitman J., Corrochano LM., Eslava AP. DIP original experiment: DIP-134174X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Phycomyces MADB interacts with MADA to form the primary photoreceptor complex for fungal phototropism. Sanz C., Rodríguez-Romero J., Idnurm A., Christie JM., Heitman J., Corrochano LM., Eslava AP. Only protein-protein interactions imex curation sanz-2009-3 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sanz C., Rodríguez-Romero J., Idnurm A., Christie JM., Heitman J., Corrochano LM., Eslava AP. DIP original experiment: DIP-134175X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Phycomyces MADB interacts with MADA to form the primary photoreceptor complex for fungal phototropism. Sanz C., Rodríguez-Romero J., Idnurm A., Christie JM., Heitman J., Corrochano LM., Eslava AP. Only protein-protein interactions imex curation b5m9p7_phybl madB protein protein phybl Phycomyces blakesleeanus MESARQPQPLSFIMEPSGPTQALVPKPPTTVQAEFTRRKNWSQSILDELRDVVHVLSPKFKILYCSPASSEFLGYQPTELVNHLFTEYLHVDDADTFSREFRNASAENKPFKAYYRLLRKDGKYTSLETRGHFFKGCFFGLARCVPAQSTRMMDTFLDLKMENEILKRKLVNMKQKQQQQNLESEKSSPITSSSEDRSETADMDDDEFDGDFDEEEFLPNAAHVYTPGVNTSYDMLESVSLFTGLRYDLGERSRGISLGLVGELTTVAQLPPSMPSTINSIERVTVHDEDEETNEQQKRVKKKRIEVEAPKICTDCGTTSAPEWRKGPKGPKTLCNACGLRWAKTSKRPDGSDI q2f7q5_phybl madA protein protein phybl Phycomyces blakesleeanus MDSFSSYPQPAEAQKPFPGHQTQFQDVPSHPFFDVVQEQSQQMVSKAGDPQVDFDLQPGTPVPAPTTTAPLSGFYSSSGFDMIGILSRLVNRPNPQINVGPIDMSCSFLVTDARQYDHPIVYCSPTFEHLTGYKGSEILGRNCRFLQAPDGRVTSGSRRQHTDNQAVYHLKAQMLQSNEHQASIINYRKGGQAFVNLITVIPICNEFNEVAFFVGLQVDLVEQPNAILEKMKDGTYLVNYQQMNMVPYIPGANTASEPVDDYFREIPAVASPASEGLNNQEILDLVQCSGENEQQLQQEWNKLLLEHSEDFIHVLSLKGFFLYCSRSSSDLLEHDPEELVGHSLSSICHPSDIVPVMREIKEAAGNSDKVVNLIYRVRRKYSGYMWMECQGKLHVDQSKGRKCLILAGRERPMYSLPRKELMQYGGAGVGSEFWVKASLSGLYLHVSGTSEDVVGYSSDFLVGASIFRYVLDKEVHEITRALASVKKGEICNLEHTMQNNKGQYVSVVSTFYPGDGSSGNKAPEFALIQIRAKDAAVLAAIKSAADDVAMSDMTEEEVAENMFSELETVRGTSWQYELHQLEVANQKLREQLENLSNPKRRKQKKKKASSAPDVQKMCAQCQSKDSPEWRKGPNGPKELCNACGLRYAKSISAKTTAMET mada-madb-1 3187656 N/A 3187659 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3187660 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false madb-mada-1 3187657 N/A 3187659 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3187660 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false mada-madb-2 3187658 N/A 3187659 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3187660 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false