DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ uehara-2009-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134146X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-2 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134134X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-3 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134132X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134141X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-5 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134135X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134145X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134138X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134142X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-9 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134148X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-10 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134136X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134150X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134139X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134143X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134140X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134147X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134149X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-17 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134137X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-18 drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134133X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation uehara-2009-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134144X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions imex curation nedd1_human Protein NEDD1 Neural precursor cell expressed developmentally down-regulated protein 1 NEDD1 protein protein human Homo sapiens Human MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAASGGVQNSGIVREAPATSIATVLPQPMTSAMGKGTVAVQEKAGLPRSINTDTLSKETDSGKNQDFSSFDDTGKSSLGDMFSPIRDDAVVNKGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLTAESKKIYMGKQESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF haus6_human HAUS augmin-like complex subunit 6 HAUS6 DGT6 FAM29A KIAA1574 protein protein human Homo sapiens Human MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYFLFQVLDQSLTKEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPGGPKFIHLMYHFARFVAMKYIKSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLLLDKIEKQMFQLHIGNVYEAGKLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSDLKHMRYRIKDDLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAKSILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLEKDTKMGTPKEKNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHLVEEVARAVLSDSPQLSEGKEIKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAIEMEENRTKEPIQMDAEHREVLPESLPVLHNQREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR wagc_drome Augmin complex subunit wac wac dgt8 wee Augmin component CG13879 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQNLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSDDDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVELQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALLDRQKTLKIPKDFSIESVIEKVDSLEQR dgt6_drome Augmin complex subunit dgt6 dgt6 Dim gamma-tubulin 6 CG11881 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDRTIIAPWKAEEKEQSEKLHRKLQGLALVHPLPDELRKLIAWDMFLKPNQVAFVHVMHYLFRLLDPAEFKRRFFWPITDKKSEANFRSSTVEYLKHLNEKHQLHWANIKSYLVVMPGGMRFINFLLEFVGFVIQELIKQREKSLGLEAGTPNVSAKVMARQNAVMKEYASSYVVNLEENTALLRDKTQKIRRLMADLSADMGVPEEQLADDGFLDEFEATAALGVERVITQPTERKFDLEASLCGLKEAIDLFQVKQAENNQSKEAVEKALRGMRVLFDCDAVTEGDFYDPLGASKMDALLNGFNRISGTIAEQLDANDHYNESNAFVTTDLQALRVELSQSEVQLNNLLKKLNEPSKKDKGSANASGSARVQTLQPATPRFESVISSKFVSTPPIRIDMGGGGGRNAPVRLALQDDFNGKQFDALSNSLLAPAPPRSARKLKALDQSTGIDLNGTLNRSKINDPMQMLRTIHKNTSKVKAAPQANLSSLGSKWKQMQASFGFDEAPVPGAAVISPQTSPTDPSDPFTPLSGSECTRIERIPRTSENNTSLIAKSAAVIKVLEVSRNVLNLSTSPSGRLDALVPHTESHQQDVAPRLQLNDRTINDSLQLDPDFNIENDKNAFNVSHKFDFDQIGGEDDLQNISDSVLKDIIF flot1_drome Flotillin-1 Flo Flo-1 CG8200 Flo1 FLODM-1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVDIARSVHAG q9vp57_drome pzg Z4 Dmel\CG7752 Pzg Q9VP57_DROME p160 z4 Dmel_CG7752 CG7752 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNNQLNPATYRKFNNLLSSGAVTVTGPSQPRILKSTRMVVPGGGGGGGASAGGASAVGGVAQQQAVNDAESGGVGIGGLATRCYICDDRCEPQTSLTDMCTTHTSTKFPNKLAQLVGEGFLVIVCGEDYVCSRCTNLVNYYDRLENDVERVKTNLISLLNKKYAINEDMGQEGSPPLKMQKMVGGSANRSLEESPSADLLRPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKATKIYKCTSCDYKTSDMRLFNTHYETCKQQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDNTCAMCHINFVNENSLRKHMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFKSTDKVVFDEHMRKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNFFKCGTCSMTFPKREMLVKHFEVHQSPSASTVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNIRFFSCSICSLTFIQETYYNHHMETHRRDKKATSAGATALNSAATALLSDEPGEATGKAGDESGEQNAEADIESLFEKLHSDKNESGEAPKPGSKGGEMVITSQEGSGGITFNITIPQPDGDQSQKDSPNTTAPVSVSIDMPNLDQAEDESQSQGSIDAKGESGEASSADSKSNAAPVSMPSLDDDNEAAAAEAEASEETKTASKAGQEKAKAKAGESAKSKEAAAAEEPQPSDEGDVVAKREATDTPTTESEANATTAEAGESGEGEVTASTGAEGEAGEAAGGEHVAMELDEAMQAQVEGGQIKFIVNENGHLLQLDNHILTDAEGNQIIVQDPEQIQQLLQSVGVLQSGEGLEGETLQMMTDGSGQMVLVHGDNNEQQLIDASLLNSEGQLIIQQGQDGEEGAHVISEDGTRIPVSVSYTEDGQPIVQVQQQVLEAAQQAASASGGADDKEAAADSAGEEVQVSEASSGTASTTVVATSTASSTGGPSGGSFFALEEFTETKTD epb41_drome Protein 4.1 homolog cora CG11949 Protein coracle protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPAEIKPSAPAEPETPTKSKPKSSSSSHGKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAESTNTPVDRTPPKFNRTLSGARLTSRSMDALALAEKEKVARKSSTLDHRGDRNADGDAHSRSPIKNKKEKDADKEAKLREKKQKEKEEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAVNGNDELNDSNKSDKSSGRRGVGIFSSGRKSKSGSPSKDGKDKSGKDKDKEVGRLGLVVTSGLGDNQQDQNLDEAARNAAKNRGSTTPGVTRQYEYAVDNDGNTSPTRKSYTPGGFRYDQDPNSRKSGADGQEQLSPTSQQKKIGLAFNYAPGNENALKETAEKLKAGQLSPRTQDKLNRGQLSPKSRAKLLQDPLLSPTTRAKLQGSAVDAAAVPLSDSQKRSYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGYVGPSKADVAAGLAGAAGSKKPGSPTKTGKGAPGAAAAAAAGAAGAAAAAAKPKKRRVKIMVITSKFDPSTKRIDAENGSIEHSTGILDPATGLIDTKYGVIDPKKGTLEALNTKTGKKEVFQGDVDGKTGNLHLVSGVADPKTGRLDDTLGQIVCITPQDNPVVELTVITSRIDPATGKIDTVNGDVERSLGVLNLDTGLLDTKYGEINTRTGELKAIDPKSGKIVVSKNVKVDPGTGQITILGIVDPKTNKIDPNQGRLIEVGQQIDPIVEVTSLAGKFDSKRNIIDPKTAQVETSGGQFDPKAGKIDTKYGQIDLVKHTITFNDPKSGKTVTRDIKIEPTTGQIVLKNQVNPKNNKPDKDYARIISLRIVQQRVDPATKAPITEVSASKDKDIVVDPKSNQIWVPTGATDPATKEQQYISSSVDPKTGYVITIYGYLDPKTNEIKKQTKLDPNTIKIEPTSGKIYTATGEVDQATGEPLYAATQVDPESGEVYTKLARVDPKTGKIVIVRILLISKTDERGRPEEIDPSTCEIDPVSGRVLKFFNKTVYVYNMIDPVTGEIVQVDPNDPRFAGARTTVTHTMTLTGEIDPVTGRIKSEYGDIDPNTGDIDPATAVTDPVTGKLILNYAQIDPSHFGKQAQVQTTTETVPITRQQFFDGVKHISKGALRRDSEGSSDDDMTAQYGADQVNEILIGSPAGQAGGKLGKPVSTPTVVKTTTKQVLTKNIDGVTHNVEEEVRNLGTGEVTYSTQEHKADATPTDLSGAYVTATAVTTRTATTHEDLGKNAKTEQLEEKTVATTRTHDPNKQQQRVVTQEVKTTATVTSGDQYQRRDSVSSTSSGDSGTPIDGPYDGASVVRTDNQKSPLFTTSATTGPHVESTRVVLGEDTPGFSGHGEIISTQTVSSKTRTVETITYKTERDGIVETRVEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVEKIEIQQQTQ msd5_drome Augmin complex subunit msd5 msd5 Mitotic spindle density protein 5 dgt7 CG2213 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly METNVDFSSISSKLYRKYAQHVRNLKDVCVSKTVMKPGAFFDSLQQMMEEEAAATTPPRDLSSVADYAELFKTLEEYPANLQKMPKKRELQRTNSTLLRGADESVAMGINTSNVSLSLTRLEEQRSAVDVYNDFKGFQRKLAKIYDEAAALDTTESIYKQKLTQLHGFAQQLEKLMPTGGESPPDAFTSEQQEKLLTIAANMEQLNYLRSNSLQLPNPNEILATGSLAARLEMFVEVLTYTLLQVSSYNMAMI dgt4_drome Augmin complex subunit dgt4 dgt4 Dim gamma-tubulin 4 CG4865 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQVRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIASLRSKLGSDLRPAILDSNDVKQCLEHLNTTHKPRLNLCRQQREFAQNQEALRSLRTAVDGLENGMEMGMIQAMDRLVEDLLPPRETNN modu_drome DNA-binding protein modulo mod CG2050 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQKKAVTVKGKKATNGEEKPLAKRVTKSTKVQEEETVVPQSPSKKSRKQPVKEVPQFSEEDESDVEEQNDEQPGDDSDFETEEAAGLIDDEAEEDEEYNSDDEEDDDDDELEPGEVSKSEGADEVDESDDDEEAPVEKPVSKKSEKANSEKSEENRGIPKVKVGKIPLGTPKNQIVFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKSVLIAFDTSTGAEAVLQAKPKALTLGDNVLSVSQPRNKEENNERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPRAFVRLASVDDIPKALKLHSTELFSRFITVRRISQESISRTSELTLVVENVGKHESYSSDALEKIFKKFGDVEEIDVVCSKAVLAFVTFKQSDAATKALAQLDGKTVNKFEWKLHRFERSTSGRAILVTNLTSDATEADLRKVFNDSGEIESIIMLGQKAVVKFKDDEGFCKSFLANESIVNNAPIFIEPNSLLKHRLLKKRLAIGQTRAPRKFQKDTKPNFGKKPFNKRPAQENGGKSFVKRARF msd1_drome Augmin complex subunit msd1 msd1 dgt9 CG13914 Mitotic spindle density protein 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDAVDKMLAGMAANRQTMNRQLAKIDEIMERSNNTLLHIESNSKAFSQNVALSETQKMYNLRPEAEMTLSKILENFKLLMSSSDQREETYSALEGCLAYRHRVEHLGSSVRKLVALYDTVGQMKNSQEEQYASEDSP dgt3_drome Augmin complex subunit dgt3 dgt3 Dim gamma-tubulin 3 CG3221 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGDLLSNSEFFKKLGVDSSNQWILYDEQMEMFFKFLSGNITDANILTERQVLEREEMQRRGEWLSASDRELKLLQIEAESPGLLNYKQQDVDALTMSIEAIEDASRDYATLLEDMMTTKHSITKHLGEVECVTAELQLREKDLIAECQSKAKQLEELQQENCRLSAEAKKAFTAPQLPPLFMHQLPLEQYFHKCDSFMQYFTLYVKENFKIQDYDEFQSAEEDLGREKAKLEDLERGIQFYALSYIRTKAKVKATQCLIDQLDLGKIHCLSLTDMAREMHDLQLLNDYQLSNTHDTLLNDLTIHIQQHTQRRIELVLYENTKLKLERAVRRHESDKKLTKIISDALSNAELLWIAIQLDCDKKRNCLDTSEELRDQAQATWQRIQTMRSINASYQGICAQFVQEIANLLSAHLGQNIKATEAKACLFEYEKFGRLLSYSFQSMLNRKSCAAVQDQLAELKRLEQTLRPFVYDSPLEQPMFENVRYLSAIYNVTQQQTRLDESGRSLRKDFLENVVGRIERDKLYRYSVVLWIWFLTEPQRMMHAIDEVKKAAAAVIRPGGGLHRK dgt2_drome Augmin complex subunit dgt2 dgt2 Dim gamma-tubulin 2 CG16969 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDDPSATLLPEHSEDLRLARDAELKKVLKLKLVLDELRRLDVGPNPSDEIKRALKLVSIGSYARLGEMEGAGQEQVLGLPSGSSFPPLNYTDRKTVRTKLSAQLRTTLQPIAELCDRIREEFPDAFGQEADLSCDQKEILRLEEEHRSGLEKLVALLTRKCTLLKETAELKLGPQLANELKLQQAQAQLVQTKAELLRGFFVHEAASRTEHSVKAHKEVEAHLDELLAAKK dgt5_drome Augmin complex subunit dgt5 Dim gamma-tubulin 5 CG8828 dgt5 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAYQEKITEFKNWATNLGCPPTALPTDDALRRIFKSGSSLLLNQLQSRIQPVDYVREVRENLLIAQVARYKDKMVPLASRSFQPPELQRYQKIQELKKHKEKANQQLTEARKEYQKLSAGIKTKNIQTISAENRKQLLESKCNILDLKLESLNKNYDQELKNKIQILGTTPVKLSARNASEAQATRAVEQALKQLETFYGMCDDGNAVNNLAEAKQRLWDQMRSTFADIPNSLLLNVVMKIKEEQLQHIMKLNESRGECTNDKPPLNNYEVKLLKTKADMLGLAAKYFAAQKELELKEERFCQDYSVFVDKLQSKVYRFNGISLGDEENADELISDYLVQYNMRNFNRSQNEFLREQIEQLRLELDAGAKQLENHDLKLGSVKQVYGDINSSINRIQQDMVQLSQIKEKILFSRNMMKNLLDDMQAATQKQNAKSQLMSTKLKVSNMSMLGAESFCLANDSVFSSTKVEFDGNCSAINSTMRRSFDNKTLVPGGAASTTLMAASGATLPSHLLEFNTFLEIPLEKFSCTPRACSFLLSANPLIVEAQELASTVQLAPGYLLTPFGALQEVRKRILWASAIAAHTSELKLNLQPLIVDPHDLRLKASRQHEEIDQLLDNLMAIGVKTQLQLEKAERIYQFLLENPLRRYVPPSKRYNNGSFADYESEFNLYYRMTTNGSSMRAPPN haus8_human HAUS augmin-like complex subunit 8 HICE1 HEC1/NDC80-interacting centrosome-associated protein 1 Sarcoma antigen NY-SAR-48 HAUS8 protein protein human Homo sapiens Human MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSPDLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS haus5_human HAUS augmin-like complex subunit 5 HAUS5 KIAA0841 protein protein human Homo sapiens Human MELAQEARELGCWAVEEMGVPVAARAPESTLRRLCLGQGADIWAYILQHVHSQRTVKKIRGNLLWYGHQDSPQVRRKLELEAAVTRLRAEIQELDQSLELMERDTEAQDTAMEQARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQQWLSSVETLLTNHPPGHVLAALEHLAAEREAEIRSLCSGDGLGDTEISRPQAPDQSDSSQTLPSMVHLIQEGWRTVGVLVSQRSTLLKERQVLTQRLQGLVEEVERRVLGSSERQVLILGLRRCCLWTELKALHDQSQELQDAAGHRQLLLRELQAKQQRILHWRQLVEETQEQVRLLIKGNSASKTRLCRSPGEVLALVQRKVVPTFEAVAPQSRELLRCLEEEVRHLPHILLGTLLRHRPGELKPLPTVLPSIHQLHPASPRGSSFIALSHKLGLPPGKASELLLPAAASLRQDLLLLQDQRSLWCWDLLHMKTSLPPGLPTQELLQIQASQEKQQKENLGQALKRLEKLLKQALERIPELQGIVGDWWEQPGQAALSEELCQGLSLPQWRLRWVQAQGALQKLCS haus1_human HAUS augmin-like complex subunit 1 HAUS1 CCDC5 HEIC Coiled-coil domain-containing protein 5 Enhancer of invasion-cluster protein protein human Homo sapiens Human MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL haus4_human HAUS augmin-like complex subunit 4 HAUS4 C14orf94 protein protein human Homo sapiens Human MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKEVRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLLGLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR haus2_human HAUS augmin-like complex subunit 2 HAUS2 C15orf25 CEP27 Centrosomal protein of 27 kDa protein protein human Homo sapiens Human MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK haus3_human HAUS augmin-like complex subunit 3 HAUS3 C4orf15 protein protein human Homo sapiens Human MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQSTAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMPVVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLYKQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTLANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED haus7_human HAUS augmin-like complex subunit 7 HAUS7 26S proteasome-associated UCH37-interacting protein 1 X-linked protein STS1769 UIP1 UCHL5IP UCHL5-interacting protein protein protein human Homo sapiens Human MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK q86lc4_drome Grip71 CG10346 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHVISTSKKTVLSDFADLETKSEYVHQNAEPTDFQFNGQRRVFVEVDKMAGLAVMRIKEKDGKTPEIQRVRKLTIDNAFCVACAKQSLEEIAVGQSGCVKLYNFRTAQLIHRFPADPQRSTVLYMDYNNTDEYIAAVRDGGDISILGTKTKQKTNTFTIDGDSTLVRFHPSKRFHLSIASYKGAVTVYDVQGMRKIFHASEAHSAPCRDISMCTSQPALLVSVGYDCKINIFDIRRNRAQASTDRLTYSHPLSTVALSECGTYLCAGNLKGELIAYDMRSTKAPLAVRSVHDAAVTRVAFVPVPSGDNQQNGSLNSSENATGLATEAPRVERAPSDELRKSIAANLLSTQNQLTSLGYGVSTPTIVRRDSFCEFLDAQGPRAVDRMSTRLGASYRDSFDWETLNRKPQPYETANRQSLCPPVASGPSSVDNSVNSSTTESLQQTLSGPLKDRSNISGDGKLMKIAETDELCEEQSANISVASSTGGGSDKENPPPVDAEMKRRLRLLSASRNSTPHHANITPQSSNPLLKPQQLLAKSSSGLSAQMDADWRKEFSELRDFVDQRCEKVERELEYVTFSNQRLLANKVTNYMDQQVENTREIRDALALLLQGDSFMREFSRLQNENEMLKAKLKFYQEQEQTESCGE ybox3_human Y-box-binding protein 3 YBX3 CSDA Cold shock domain-containing protein A DBPA DNA-binding protein A Single-strand DNA-binding protein NF-GMB protein protein human Homo sapiens Human MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE rbm7_human RNA-binding protein 7 RNA-binding motif protein 7 RBM7 protein protein human Homo sapiens Human MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH haus6-nedd1-1 3187187 N/A 3187206 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role bait bait Region 480-955 Region 480-955 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false wac-dgt6-1 3187188 N/A 3187208 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187209 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false dgt2-cora-1 3187189 N/A 3187210 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187211 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187208 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187212 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187213 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187214 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187215 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187216 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187217 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187218 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187209 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187219 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false haus8-haus6-1 3187190 N/A 3187220 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false msd1-dgt6-1 3187191 N/A 3187216 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187209 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false nedd1-haus6-1 3187192 N/A 3187206 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8NHV4:p.Ser411Ala S411A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false haus5-haus6-1 3187193 N/A 3187221 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false haus1-haus6-1 3187194 N/A 3187222 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false haus1-haus2-1 3187195 N/A 3187223 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187224 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187222 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187220 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187225 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187226 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187221 unspecified role unspecified role unspecified role unspecified role GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false grip71-dgt6-1 3187196 N/A 3187227 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187209 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false haus6-haus8-1 3187197 N/A 3187220 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3187207 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false haus7-haus6-1 3187198 N/A 3187226 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false haus2-haus6-1 3187199 N/A 3187224 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false haus3-haus6-1 3187200 N/A 3187225 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false haus2-haus6-2 3187201 N/A 3187224 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey Region 1-438 Region 1-438 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false haus8-haus6-2 3187202 N/A 3187220 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3187207 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false haus6-haus1-1 3187203 N/A 3187228 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187223 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187224 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187222 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187220 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187229 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187225 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187226 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187221 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3187207 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false msd5-dgt6-1 3187204 N/A 3187213 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3187209 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false haus4-haus6-1 3187205 N/A 3187223 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3187207 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false