DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ popovych-2009-1 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Popovych N., Tzeng SR., Tonelli M., Ebright RH., Kalodimos CG. DIP original experiment: DIP-134176X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for cAMP-mediated allosteric control of the catabolite activator protein. Popovych N., Tzeng SR., Tonelli M., Ebright RH., Kalodimos CG. Only protein-protein interactions imex curation popovych-2009-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Popovych N., Tzeng SR., Tonelli M., Ebright RH., Kalodimos CG. DIP original experiment: DIP-134177X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for cAMP-mediated allosteric control of the catabolite activator protein. Popovych N., Tzeng SR., Tonelli M., Ebright RH., Kalodimos CG. Only protein-protein interactions imex curation crp_ecoli cAMP-activated global transcriptional regulator CRP Catabolite activator protein crp cap csm b3357 cAMP regulatory protein JW5702 cAMP receptor protein Catabolite gene activator protein protein ecoli Escherichia coli (strain K12) MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR DCBC24FA46C61B3D crp-3 3186852 N/A 3186854 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false crp-2 3186853 N/A 3186854 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false