DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sengupta-2009-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Sengupta T., Cohet N., Morlé F., Bieker JJ. DIP original experiment: DIP-133831X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Distinct modes of gene regulation by a cell-specific transcriptional activator. Sengupta T., Cohet N., Morlé F., Bieker JJ. Only protein-protein interactions imex curation sengupta-2009-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sengupta T., Cohet N., Morlé F., Bieker JJ. DIP original experiment: DIP-133834X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Distinct modes of gene regulation by a cell-specific transcriptional activator. Sengupta T., Cohet N., Morlé F., Bieker JJ. Only protein-protein interactions imex curation sengupta-2009-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sengupta T., Cohet N., Morlé F., Bieker JJ. DIP original experiment: DIP-133832X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Distinct modes of gene regulation by a cell-specific transcriptional activator. Sengupta T., Cohet N., Morlé F., Bieker JJ. Only protein-protein interactions imex curation sengupta-2009-4 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Sengupta T., Cohet N., Morlé F., Bieker JJ. DIP original experiment: DIP-133833X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Distinct modes of gene regulation by a cell-specific transcriptional activator. Sengupta T., Cohet N., Morlé F., Bieker JJ. Only protein-protein interactions imex curation klf1_mouse Krueppel-like factor 1 Klf1 Elkf Erythroid krueppel-like transcription factor protein protein mouse Mus musculus Mouse MASAETVLPSISTLTTLGQFLDTQEDFLKWWRSEETQDLGPGPPNPTGPSLHVSLKSEDPSGEDDERDVTCAWDPDLFLTNFPGSESPGTSRTCALAPSVGPVAQFEPPESLGAYAGGPGLVTGPLGSEEHTSWAHPTPRPPAPEPFVAPALAPGLAPKAQPSYSDSRAGSVGGFFPRAGLAVPAAPGAPYGLLSGYPALYPAPQYQGHFQLFRGLAAPSAGGTAPPSFLNCLGPGTVATELGATAIAGDAGLSPGTAPPKRSRRTLAPKRQAAHTCGHEGCGKSYSKSSHLKAHLRTHTGEKPYACSWDGCDWRFARSDELTRHYRKHTGHRPFCCGLCPRAFSRSDHLALHMKRHL taf9_human Transcription initiation factor TFIID subunit 9 Transcription initiation factor TFIID 31 kDa subunit Transcription initiation factor TFIID 32 kDa subunit RNA polymerase II TBP-associated factor subunit G STAF31/32 TAF9 TAF2G TAFII31 protein protein human Homo sapiens Human MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL taf9_mouse Transcription initiation factor TFIID subunit 9 Taf9 Taf2g RNA polymerase II TBP-associated factor subunit G Transcription initiation factor TFIID 31 kDa subunit Transcription initiation factor TFIID 32 kDa subunit protein protein mouse Mus musculus Mouse MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKAPAPAGRITVPRLSVGSVSSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPASQSPAVKASIPATSTVQNVLINPSLIGSKNILITTNMVSQNTAESANALKRKREDDDDDDDDDDDDDYDNM klf1-taf9-1 3185203 N/A 3185207 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3185208 unspecified role unspecified role prey prey Region 1-140 Region 1-140 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false taf9-klf1-1 3185204 N/A 3185208 unspecified role unspecified role bait bait Region 75-147 Region 75-147 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3185207 unspecified role unspecified role prey prey Region 287-376 Region 287-376 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false klf1-taf9-2 3185205 N/A 3185209 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3185207 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false klf1-taf9-3 3185206 N/A 3185208 unspecified role unspecified role prey prey in vitro In vitro N/A 3185207 unspecified role unspecified role bait bait Region 287-376 Region 287-376 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false