DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ leiman-2009-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. DIP original experiment: DIP-133826X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Type VI secretion apparatus and phage tail-associated protein complexes share a common evolutionary origin. Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. Only protein-protein interactions imex curation leiman-2009-2 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. DIP original experiment: DIP-133830X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Type VI secretion apparatus and phage tail-associated protein complexes share a common evolutionary origin. Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. Only protein-protein interactions imex curation leiman-2009-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. DIP original experiment: DIP-133827X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Type VI secretion apparatus and phage tail-associated protein complexes share a common evolutionary origin. Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. Only protein-protein interactions imex curation leiman-2009-4 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. DIP original experiment: DIP-133828X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Type VI secretion apparatus and phage tail-associated protein complexes share a common evolutionary origin. Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. Only protein-protein interactions imex curation leiman-2009-5 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. DIP original experiment: DIP-133829X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Type VI secretion apparatus and phage tail-associated protein complexes share a common evolutionary origin. Leiman PG., Basler M., Ramagopal UA., Bonanno JB., Sauder JM., Pukatzki S., Burley SK., Almo SC., Mekalanos JJ. Only protein-protein interactions imex curation a0a0h2vbp9_ecol6 c3393 protein protein ecol6 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) MEALMNVQFFDHAHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAIAPESVLMQDGAFSLTAPPVQGMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMRGQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPLRHPSGLFDGETEAVWGLNTAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADNFLQQGDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTTSAARDRSYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKEQRGEGFELRTDLWGAVRAKKGIFISADAQDKAQGQVLEMQPALARLSAALVTMESLAASAQQAQALAADVSRQQTLLQQKIEQLQQEVLLGSAPKGVALVSGEDMQLSASDNLTLTAGKQLDIGVQKDFTLAAGKQLSLYSRAGAKLFSSHNDIDIQAQGGNLTTWSTQDTYISSGKKLVVTAQDELTLICGGGYIKIKSGNVEIGGPGKLLVKNAGIKKAGSGSMQGVMKSFEPESFDENFIISNPASGKPIANQKYEIHMPDGSVIAGITDAMGYSSLVASKASDDLKIILKK BAB07210D46C3CA5 a0a0h2vcj7_ecol6 c3391 protein protein ecol6 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSPYLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKDPSREKHNHLERIEFRYEKITWTYKDGNIIHSDSWNERPSA 6A84D061D43AC499 q9i1b2_pseae PA2367 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTLNEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELTAQKDDGTKEGTAASTWDLAANQLVK A4F50F0C183620E4 maje_pseae Major exported protein hcpA hcpB hcpC Secreted protein hcp PA0263 PA1512 PA5267 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG 8565ABE2F64B9577 vgrg-1 3185182 N/A 3185187 unspecified role unspecified role unspecified role unspecified role Region 2-481 Region 2-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hcp1-4 3185183 N/A 3185188 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false vgrg-2 3185184 N/A 3185187 unspecified role unspecified role unspecified role unspecified role Region 2-481 Region 2-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hcp3-1 3185185 N/A 3185189 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hcp2-1 3185186 N/A 3185190 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false