DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ day-2009-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. DIP original experiment: DIP-133813X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of human CDK4 in complex with a D-type cyclin. Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. Only protein-protein interactions imex curation day-2009-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. DIP original experiment: DIP-133814X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of human CDK4 in complex with a D-type cyclin. Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. Only protein-protein interactions imex curation cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI ccnd1-cdk4-18 3184866 N/A 3184868 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3184869 unspecified role unspecified role unspecified role unspecified role Region 15-271 Region 15-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ccnd1-cdk4-19 3184867 N/A 3184868 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3184869 unspecified role unspecified role unspecified role unspecified role Region 15-271 Region 15-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false