DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ takaki-2009-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Takaki T., Echalier A., Brown NR., Hunt T., Endicott JA., Noble ME. DIP original experiment: DIP-133809X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The structure of CDK4/cyclin D3 has implications for models of CDK activation. Takaki T., Echalier A., Brown NR., Hunt T., Endicott JA., Noble ME. Only protein-protein interactions imex curation takaki-2009-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm light scattering light scattering predetermined predetermined participant predetermined Takaki T., Echalier A., Brown NR., Hunt T., Endicott JA., Noble ME. DIP original experiment: DIP-133810X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The structure of CDK4/cyclin D3 has implications for models of CDK activation. Takaki T., Echalier A., Brown NR., Hunt T., Endicott JA., Noble ME. Only protein-protein interactions imex curation takaki-2009-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Takaki T., Echalier A., Brown NR., Hunt T., Endicott JA., Noble ME. DIP original experiment: DIP-133811X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The structure of CDK4/cyclin D3 has implications for models of CDK activation. Takaki T., Echalier A., Brown NR., Hunt T., Endicott JA., Noble ME. Only protein-protein interactions imex curation ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE ccnd3-cdk4-9 3184852 N/A 3184855 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3184856 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ccnd3-cdk4-10 3184853 N/A 3184855 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3184856 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ccnd3-cdk4-11 3184854 N/A 3184855 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3184856 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false