DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kanno-2009-1 thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kanno R., Koike-Takeshita A., Yokoyama K., Taguchi H., Mitsuoka K. DIP original experiment: DIP-132146X Structure (London, England : 1993) 2009 IMEx Cryo-EM structure of the native GroEL-GroES complex from thermus thermophilus encapsulating substrate inside the cavity. Kanno R., Koike-Takeshita A., Yokoyama K., Taguchi H., Mitsuoka K. Only protein-protein interactions imex curation kanno-2009-2 thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Kanno R., Koike-Takeshita A., Yokoyama K., Taguchi H., Mitsuoka K. DIP original experiment: DIP-132147X Structure (London, England : 1993) 2009 IMEx Cryo-EM structure of the native GroEL-GroES complex from thermus thermophilus encapsulating substrate inside the cavity. Kanno R., Koike-Takeshita A., Yokoyama K., Taguchi H., Mitsuoka K. Only protein-protein interactions imex curation ch10_thet8 Co-chaperonin GroES groES 10 kDa chaperonin Chaperonin-10 chpS groS hsp10 TTHA0272 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAAEVKTVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKGKVIAVGTGRVLENGQRVPLEVKEGDIVVFAKYGGTEIEIDGEEYVILSERDLLAVLQ ch60_thet8 Chaperonin GroEL groEL 60 kDa chaperonin Chaperonin-60 Heat shock protein 60 cpnL groL hsp60 mopA TTHA0271 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVELEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIEKAVEAAVEKIKALAIPVEDRKAIEEVATISANDPEVGKLIADAMEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVAQTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVISEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYAREKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLRAISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGFNAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPASAGAGDMDF grol-gros-14 3184195 N/A 3184197 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) N/A 3184198 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) direct interaction direct interaction false false false grol-gros-15 3184196 N/A 3184197 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) N/A 3184198 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) direct interaction direct interaction false false false