DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ watanabe-2009-1 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. DIP original experiment: DIP-133732X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The nature of the TRAP-Anti-TRAP complex. Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. Only protein-protein interactions imex curation watanabe-2009-2 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. DIP original experiment: DIP-133736X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The nature of the TRAP-Anti-TRAP complex. Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. Only protein-protein interactions imex curation watanabe-2009-3 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. DIP original experiment: DIP-133733X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The nature of the TRAP-Anti-TRAP complex. Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. Only protein-protein interactions imex curation watanabe-2009-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. DIP original experiment: DIP-133737X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The nature of the TRAP-Anti-TRAP complex. Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. Only protein-protein interactions imex curation watanabe-2009-5 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. DIP original experiment: DIP-133734X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The nature of the TRAP-Anti-TRAP complex. Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. Only protein-protein interactions imex curation watanabe-2009-6 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. DIP original experiment: DIP-133735X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The nature of the TRAP-Anti-TRAP complex. Watanabe M., Heddle JG., Kikuchi K., Unzai S., Akashi S., Park SY., Tame JR. Only protein-protein interactions imex curation mtrb_geose Transcription attenuation protein MtrB mtrB Trp RNA-binding attenuation protein Tryptophan RNA-binding attenuator protein protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK rtpa_bacsu Tryptophan RNA-binding attenuator protein inhibitory protein rtpA Anti-TRAP protein yczA BSU02530 protein protein bacsu Bacillus subtilis MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK E9956FB4FE0E7A85 mtrb-3 3183149 N/A 3183155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false at-mtrb-1 3183150 N/A 3183156 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3183155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false at-mtrb-2 3183151 N/A 3183156 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3183155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false at-mtrb-3 3183152 N/A 3183156 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3183155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false at-1 3183153 N/A 3183156 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mtrb-4 3183154 N/A 3183155 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false