DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mcelroy-2009-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132152X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation mcelroy-2009-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132157X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation mcelroy-2009-3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132155X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation mcelroy-2009-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132153X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation mcelroy-2009-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132158X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation mcelroy-2009-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132156X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation mcelroy-2009-7 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132154X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions imex curation il7ra_human Interleukin-7 receptor subunit alpha IL7R CDw127 protein protein human Homo sapiens Human MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ il7_human Interleukin-7 IL7 protein protein human Homo sapiens Human MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH il7-il7r-4 3182594 n/a 3182601 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3182602 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false il7r-il7-1 3182595 n/a 3182601 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3182602 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false il7r-il7-2 3182596 n/a 3182601 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3182602 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false il7-il7r-5 3182597 n/a 3182601 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3182602 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false il7r-il7-3 3182598 n/a 3182601 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3182602 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false il7r-il7-4 3182599 n/a 3182601 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3182602 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false il7r-il7-5 3182600 n/a 3182601 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3182602 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false