DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ krumm-2008-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Krumm B., Meng X., Li Y., Xiang Y., Deng J. DIP original experiment: DIP-133604X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structural basis for antagonism of human interleukin 18 by poxvirus interleukin 18-binding protein. Krumm B., Meng X., Li Y., Xiang Y., Deng J. Only protein-protein interactions imex curation krumm-2008-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krumm B., Meng X., Li Y., Xiang Y., Deng J. DIP original experiment: DIP-133605X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structural basis for antagonism of human interleukin 18 by poxvirus interleukin 18-binding protein. Krumm B., Meng X., Li Y., Xiang Y., Deng J. Only protein-protein interactions imex curation q9iw12_9poxv protein protein ectromelia virus Ectromelia virus MRILFLIAFMYGCVHSYVNAVETKCPNLDIVTSSGEFHCSGCVEHMPEFSYMYWLAKDMKSDEDTKFIEHLGDGINEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLTTLDGVSKKNIWLK il18_human Interleukin-18 IL18 IGIF IL1F4 Iboctadekin Interferon gamma-inducing factor Interleukin-1 gamma protein protein human Homo sapiens Human MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED il18-q9iw12_9poxv-1 3181961 N/A 3181963 unspecified role unspecified role unspecified role unspecified role Region 21-126 Region 21-126 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3181964 unspecified role unspecified role unspecified role unspecified role Region 37-193 Region 37-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false il18-q9iw12_9poxv-2 3181962 N/A 3181963 unspecified role unspecified role unspecified role unspecified role Region 21-126 Region 21-126 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3181964 unspecified role unspecified role unspecified role unspecified role Region 37-193 Region 37-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false