DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2008-19 Salmonella typhimurium Salmonella typhimurium crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Zhao G., Weatherspoon N., Kong W., Curtiss R., Shi Y. DIP original experiment: DIP-133601X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A dual-signal regulatory circuit activates transcription of a set of divergent operons in Salmonella typhimurium. Zhao G., Weatherspoon N., Kong W., Curtiss R., Shi Y. Only protein-protein interactions imex curation slya_salty Transcriptional regulator SlyA slyA Cytolysin SlyA Salmolysin STM1444 protein protein salty Salmonella typhimurium MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKADALIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSHD 2D37EB004F2D7439 slya-1 3181838 N/A 3181839 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Salmonella typhimurium Salmonella typhimurium direct interaction direct interaction false false false