DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pei-2008-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132185X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions imex curation pei-2008-2 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132188X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions imex curation pei-2008-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132186X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions imex curation pei-2008-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132187X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions imex curation odpb_geose Pyruvate dehydrogenase E1 component subunit beta pdhB protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MAQMTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGLQAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQFFGFVYEVMDSICGQMARIRYRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEHLKLYRSFRQEVPEGEYTIPIGKADIKREGKDITIIAYGAMVHESLKAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAEINERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF odpa_geose Pyruvate dehydrogenase E1 component subunit alpha pdhA protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MGVKTFQFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDDPTRYRSKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMFEELPFNLKEQYEIYKEKESK odp2_geose Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex pdhC E2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLMEA pdha-pdhb-8 3181734 N/A 3181738 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3181739 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pdha-pdhb-9 3181735 N/A 3181740 unspecified role unspecified role unspecified role unspecified role Region 1-171 Region 1-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3181738 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3181739 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false pdha-pdhb-10 3181736 N/A 3181738 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3181739 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pdha-pdhb-11 3181737 N/A 3181740 unspecified role unspecified role unspecified role unspecified role Region 123-171 Region 123-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3181738 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3181739 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false