DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mandal-2008-1 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. DIP original experiment: DIP-133582X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The nuclear membrane organization of leukotriene synthesis. Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. Only protein-protein interactions imex curation mandal-2008-2 rat Rattus norvegicus (Rat) Rat crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. DIP original experiment: DIP-133583X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The nuclear membrane organization of leukotriene synthesis. Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. Only protein-protein interactions imex curation mandal-2008-3 rat Rattus norvegicus (Rat) Rat fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. DIP original experiment: DIP-133584X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The nuclear membrane organization of leukotriene synthesis. Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. Only protein-protein interactions imex curation al5ap_rat Arachidonate 5-lipoxygenase-activating protein Alox5ap Flap FLAP MK-886-binding protein protein protein rat Rattus norvegicus (Rat) Rat MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP lox5_rat Polyunsaturated fatty acid 5-lipoxygenase Alox5 Arachidonate 5-lipoxygenase protein protein rat Rattus norvegicus (Rat) Rat MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEELGEIYLVKIEKRKYRLHDDWYLKYITLKTPHDYIEFPCYRWITGEGEIVLRDGCAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFHIHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGLFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEAIQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYYYLSPDRIPNSVAI alox5-alox5ap-1 3181566 N/A 3181569 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3181570 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false alox5ap-1 3181567 N/A 3181569 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat physical association physical association false false false alox5-alox5ap-2 3181568 N/A 3181569 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat N/A 3181570 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat physical association physical association false false false